Open main menu

Biolecture.org β

Changes

Secondary protein structure prediction programs

1,224 bytes added, 21:00, 17 June 2016
Created page with "<p>I couldn’t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.</p> <p> </p> <p><strong>1. Find the ..."
<p>I couldn&rsquo;t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.</p>

<p>&nbsp;</p>

<p><strong>1. Find the amino acid sequence from the NCBI.</strong></p>

<p>Ex) Antibody</p>

<p><img alt="" src="/ckfinder/userfiles/images/ab1(1).JPG" style="height:302px; width:800px" /></p>

<p><img alt="" src="/ckfinder/userfiles/images/ab11.JPG" style="height:314px; width:800px" /></p>

<p>&gt; Sequence:</p>

<p>LFWIPASISDVVMTQTPLSLPVSLGDQASISCRSSQNLVHNNGNTYLYWFLQKSGQSPKLLIYRASIRFSGVPDRFSGSGSETDFTLKISRVEAEDLGVYFCFQGTHVPWTFGGGTKLEIK</p>

<p>&nbsp;</p>

<p><strong>2. Using protein structure predicting program, predict the secondary structure by using amino acid sequence.</strong></p>

<p>&gt; Prediction program website:</p>

<p>https://www.predictprotein.org/home#</p>

<p>&nbsp;</p>

<p><img alt="" src="/ckfinder/userfiles/images/ab3.JPG" style="height:497px; width:800px" /></p>

<p>&nbsp;</p>

<p>&nbsp;</p>

<p>&gt; Results</p>

<p>&nbsp;</p>

<p><img alt="" src="/ckfinder/userfiles/images/ab4.JPG" style="height:874px; width:703px" /></p>

<p>&nbsp;</p>

<p><img alt="" src="/ckfinder/userfiles/images/ab5.JPG" style="height:832px; width:691px" /></p>
Anonymous user
Retrieved from "https://Biolecture.org/Special:MobileDiff/9759"