Secondary protein structure prediction programs
From Biolecture.org
Revision as of 21:00, 17 June 2016 by imported>Mi Rae Yeo (Created page with "<p>I couldn’t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.</p> <p> </p> <p><strong>1. Find the ...")
I couldn’t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.
1. Find the amino acid sequence from the NCBI.
Ex) Antibody
> Sequence:
LFWIPASISDVVMTQTPLSLPVSLGDQASISCRSSQNLVHNNGNTYLYWFLQKSGQSPKLLIYRASIRFSGVPDRFSGSGSETDFTLKISRVEAEDLGVYFCFQGTHVPWTFGGGTKLEIK
2. Using protein structure predicting program, predict the secondary structure by using amino acid sequence.
> Prediction program website:
https://www.predictprotein.org/home#
> Results
