Difference between revisions of "Secondary protein structure prediction programs"
imported>Mi Rae Yeo (Created page with "<p>I couldn’t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.</p> <p> </p> <p><strong>1. Find the ...") |
imported>Mi Rae Yeo |
||
| Line 8: | Line 8: | ||
<p><img alt="" src="/ckfinder/userfiles/images/ab1(1).JPG" style="height:302px; width:800px" /></p> | <p><img alt="" src="/ckfinder/userfiles/images/ab1(1).JPG" style="height:302px; width:800px" /></p> | ||
| + | |||
| + | <p> </p> | ||
| + | |||
| + | <p> </p> | ||
<p><img alt="" src="/ckfinder/userfiles/images/ab11.JPG" style="height:314px; width:800px" /></p> | <p><img alt="" src="/ckfinder/userfiles/images/ab11.JPG" style="height:314px; width:800px" /></p> | ||
| Line 14: | Line 18: | ||
<p>LFWIPASISDVVMTQTPLSLPVSLGDQASISCRSSQNLVHNNGNTYLYWFLQKSGQSPKLLIYRASIRFSGVPDRFSGSGSETDFTLKISRVEAEDLGVYFCFQGTHVPWTFGGGTKLEIK</p> | <p>LFWIPASISDVVMTQTPLSLPVSLGDQASISCRSSQNLVHNNGNTYLYWFLQKSGQSPKLLIYRASIRFSGVPDRFSGSGSETDFTLKISRVEAEDLGVYFCFQGTHVPWTFGGGTKLEIK</p> | ||
| + | |||
| + | <p> </p> | ||
<p> </p> | <p> </p> | ||
| Line 36: | Line 42: | ||
<p><img alt="" src="/ckfinder/userfiles/images/ab4.JPG" style="height:874px; width:703px" /></p> | <p><img alt="" src="/ckfinder/userfiles/images/ab4.JPG" style="height:874px; width:703px" /></p> | ||
| + | |||
| + | <p> </p> | ||
| + | |||
| + | <p> </p> | ||
<p> </p> | <p> </p> | ||
<p><img alt="" src="/ckfinder/userfiles/images/ab5.JPG" style="height:832px; width:691px" /></p> | <p><img alt="" src="/ckfinder/userfiles/images/ab5.JPG" style="height:832px; width:691px" /></p> | ||
| + | |||
| + | <p> </p> | ||
| + | |||
| + | <p> </p> | ||
| + | |||
| + | <p>> Other protein structure prediction program websites</p> | ||
| + | |||
| + | <p>https://en.wikipedia.org/wiki/List_of_protein_secondary_structure_prediction_programs</p> | ||
| + | |||
| + | <p>http://sparks-lab.org/server/SPIDER2/<br /> | ||
| + | </p> | ||
| + | |||
| + | <p> </p> | ||
| + | |||
| + | <p>> DNA to RNA to Protein sequencing program</p> | ||
| + | |||
| + | <p>http://www.attotron.com/cybertory/analysis/trans.htm</p> | ||
| + | |||
| + | <p> </p> | ||
Latest revision as of 21:02, 17 June 2016
I couldn’t success previous homework, programming the protein sequence program, so I use the amino acid sequence in the NCBI.
1. Find the amino acid sequence from the NCBI.
Ex) Antibody
> Sequence:
LFWIPASISDVVMTQTPLSLPVSLGDQASISCRSSQNLVHNNGNTYLYWFLQKSGQSPKLLIYRASIRFSGVPDRFSGSGSETDFTLKISRVEAEDLGVYFCFQGTHVPWTFGGGTKLEIK
2. Using protein structure predicting program, predict the secondary structure by using amino acid sequence.
> Prediction program website:
https://www.predictprotein.org/home#
> Results
> Other protein structure prediction program websites
https://en.wikipedia.org/wiki/List_of_protein_secondary_structure_prediction_programs
http://sparks-lab.org/server/SPIDER2/
> DNA to RNA to Protein sequencing program
http://www.attotron.com/cybertory/analysis/trans.htm
