Revision history of "Programmed cell death protein 1 precursor (PD-1)"

From Biolecture.org

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 21:33, 26 May 2016imported>Jungsu Shin. . (759 bytes) (+97)
  • (cur | prev) 21:27, 26 May 2016imported>Jungsu Shin. . (662 bytes) (+662). . (Created page with "<p>For Homo Sapiens</p> <p>Codon</p> <pre> MQIPQAPWPVVWAVLQLGWRPGWFLDSPDRPWNPPTFSPALLVVTEGDNATFTCSFSNTSESFVLNWYRM SPSNQTDKLAAFPEDRSQPGQDCRFRVTQLPNGRDFHMSVVRARRNDSGTYLCGAISLAPKA...")