Revision history of "Melanoma-associated antigen C2"

From Biolecture.org

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 04:12, 4 June 2018imported>MJ. . (773 bytes) (+15)
  • (cur | prev) 04:12, 4 June 2018imported>MJ. . (758 bytes) (+118)
  • (cur | prev) 04:10, 4 June 2018imported>MJ. . (640 bytes) (+640). . (Created page with "<p> #FASTA</p> <p>>NP_057333.1 melanoma-associated antigen C2 [Homo sapiens]<br /> MPPVPGVPFRNVDNDSPTSVELEDWVDAQHPTDEEEEEASSASSTLYLVFSPSSFSTSSSLILGGPEEEE<br /> VPSGVIPNL...")