Revision history of "Colorectal mutant cancer protein isoform 1"

From Biolecture.org

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 03:54, 4 June 2018‎ imported>MJ‎ . . (1,564 bytes) (+133)‎
  • (cur | prev) 03:54, 4 June 2018‎ imported>MJ‎ . . (1,431 bytes) (+1,431)‎ . . (Created page with "<p> #FASTA</p> <p>>NP_001078846.1 colorectal mutant cancer protein isoform 1 [Homo sapiens]<br /> MMAAAAAAAAGSSSSGGGGGGSGSSSSSSDTSSTGEEERMRRLFQTCDGDGDGYISRNDLLMVCRQLNME<...")
Retrieved from "https://Biolecture.org/Colorectal_mutant_cancer_protein_isoform_1"