Revision history of "Circadian clock protein PASD1"

From Biolecture.org

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 04:30, 4 June 2018‎ imported>MJ‎ . . (1,209 bytes) (+100)‎
  • (cur | prev) 04:21, 4 June 2018‎ imported>MJ‎ . . (1,109 bytes) (+1,109)‎ . . (Created page with "<p> #FASTA</p> <p>>NP_775764.2 circadian clock protein PASD1 [Homo sapiens]<br /> MKMRGEKRRDKVNPKSSQRKLNWIPSFPTYDYFNQVTLQLLDGFMITLSTDGVIICVAENISSLLGHLPA<br /> EIVGKKLLSL...")
Retrieved from "https://Biolecture.org/Circadian_clock_protein_PASD1"