Revision history of "Teashirt homolog 2 isoform 2"

From Biolecture.org

Diff selection: Mark the radio boxes of the revisions to compare and hit enter or the button at the bottom.
Legend: (cur) = difference with latest revision, (prev) = difference with preceding revision, m = minor edit.

  • (cur | prev) 04:50, 4 June 2018‎ imported>MJ‎ . . (1,495 bytes) (+103)‎
  • (cur | prev) 04:42, 4 June 2018‎ imported>MJ‎ . . (1,392 bytes) (+1,392)‎ . . (Created page with "<p> #FASTA</p> <p>>NP_001180350.1 teashirt homolog 2 isoform 2 [Homo sapiens]<br /> MMAAALLHYTGYAQEEQLKEEEEIKEEEEEEDSGSVAQLQGGNDTGTDEELETGPEQKGCFSYQNSPGSH<br /> LSNQDAEN...")
Retrieved from "https://Biolecture.org/Teashirt_homolog_2_isoform_2"