imported>S |
imported>Yeong Jae Kim |
Line 1: |
Line 1: |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">1.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">What is transcriptomics?<o:p></o:p></span></p> | + | <h1><span style="font-size:12px">1. ATAD5 ATPase family, AAA domain containing 5 [ <em>Homo sapiens</em> (human) ]</span></h1> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Thranscriptomics is discipline of biology that study about the set of all RNA moleculs, including mRNA, rRNA, tRNA and non-coding RNA transcribed in one cell or a population of cells<o:p></o:p></span></p>
| + | |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | <p><span style="font-size:12px">Gene ID: 79915, updated on 26-May-2016</span></p> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">2.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Relationship between genomics and transcriptomics<o:p></o:p></span></p> | + | |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Transcriptomics is expressional genomics. <o:p></o:p></span></p>
| + | <p><span style="font-size:12px"><i want to understand about PCNA and ATAD5 role. so pick that></span></p> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">3.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">What are mRNAs?<o:p></o:p></span></p> | + | <p><span style="font-size:12px">source comes from. http://www.ncbi.nlm.nih.gov/protein/26080431?report=fasta</span></p> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">mRNA is large family of RNA molecules that convey genetic information from DNA to the ribosome, where they specify the amino acid sequence if the protein products of gene expressing<o:p></o:p></span></p> | + | |
− | <p class="MsoListParagraph" style="margin: 0cm 0cm 8pt 40pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black; line-height: 107%"><o:p> </o:p></span></p>
| + | <h1>ATPase family AAA domain-containing protein 5 [Homo sapiens]</h1> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">4.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">How to measure RNA expression?<o:p></o:p></span></p>
| + | <p>NCBI Reference Sequence: NP_079133.3</p> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif">RNA-seq method is frequently used for measuring RNA expression.<o:p></o:p></span></p>
| + | |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | <pre> |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p> | + | >gi|26080431|ref|NP_079133.3| ATPase family AAA domain-containing protein 5 [Homo sapiens] |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">5.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Relationship between Transcriptome and Proteome.<o:p></o:p></span></p>
| + | MVGVLAMAAAAAPPPVKDCEIEPCKKRKKDDDTSTCKTITKYLSPLGKTRDRVFAPPKPSNILDYFRKTS |
− | <p style="background: white; margin: 4.8pt 0cm 6pt; line-height: 14.3pt; text-indent: 20.25pt; mso-char-indent-count: 1.5"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Proteome is expressional Transcriptome. <o:p></o:p></span></p>
| + | PTNEKTQLGKECKIKSPESVPVDSNKDCTTPLEMFSNVEFKKKRKRVNLSHQLNNIKTENEAPIEISSDD |
− | <p class="MsoListParagraph" style="margin: 0cm 0cm 8pt 40pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black; line-height: 107%"><o:p> </o:p></span></p> | + | SKEDYSLNNDFVESSTSVLRYKKQVEVLAENIQDTKSQPNTMTSLQNSKKVNPKQGTTKNDFKKLRKRKC |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | RDVVDLSESLPLAEELNLLKKDGKDTKQMENTTSHANSRDNVTEAAQLNDSIITVSYEEFLKSHKENKVE |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">6.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">What is a UTR?<o:p></o:p></span></p> | + | EIPDSTMSICVPSETVDEIVKSGYISESENSEISQQVRFKTVTVLAQVHPIPPKKTGKIPRIFLKQKQFE |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white; mso-bidi-font-weight: bold">Untranslated region </span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white">(or<span class="apple-converted-space"> </span><span style="mso-bidi-font-weight: bold">UTR</span>) refers to either of two sections, one on each side of a<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="Coding sequence" href="http://en.wikipedia.org/wiki/Coding_sequence"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; text-underline: none">coding sequence</span></a></span><span class="apple-converted-space"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white"> </span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white">on a strand of<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="MRNA" href="http://en.wikipedia.org/wiki/MRNA"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; text-underline: none">mRNA</span></a></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white">. If it is found on the 5' side, it is called the<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="Five prime untranslated region" href="http://en.wikipedia.org/wiki/Five_prime_untranslated_region"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; text-underline: none">5' UTR</span></a></span><span class="apple-converted-space"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white"> </span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white">(or<span class="apple-converted-space"> </span><span style="mso-bidi-font-weight: bold">leader sequence</span>), or if it is found on the 3' side, it is called the<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="Three prime untranslated region" href="http://en.wikipedia.org/wiki/Three_prime_untranslated_region"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; text-underline: none">3' UTR</span></a></span><span class="apple-converted-space"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white"> </span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white">(or<span class="apple-converted-space"> </span><span style="mso-bidi-font-weight: bold">trailer sequence</span>).<o:p></o:p></span></p>
| + | MENSLSDPENEQTVQKRKSNVVIQEEELELAVLEAGSSEAVKPKCTLEERQQFMKAFRQPASDALKNGVK |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif"><o:p> </o:p></span></p>
| + | KSSDKQKDLNEKCLYEVGRDDNSKKIMENSGIQMVSKNGNLQLHTDKGSFLKEKNKKLKKKNKKTLDTGA |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">7.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">What is ncRNA ?<o:p></o:p></span></p>
| + | IPGKNREGNTQKKETTFFLKEKQYQNRMSLRQRKTEFFKSSTLFNNESLVYEDIANDDLLKVSSLCNNNK |
− | <p class="MsoNormal" style="margin: 0cm 0cm 8pt 15pt; mso-para-margin-left: 1.5gd"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white; line-height: 107%">A<span class="apple-converted-space"> </span><span style="mso-bidi-font-weight: bold">non-coding RNA</span><span class="apple-converted-space"> </span>(<span style="mso-bidi-font-weight: bold">ncRNA</span>) is a functional<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="RNA" href="http://en.wikipedia.org/wiki/RNA"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; line-height: 107%; text-underline: none">RNA</span></a></span><span class="apple-converted-space"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white; line-height: 107%"> </span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white; line-height: 107%">molecule that is not<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="Translation (genetics)" href="http://en.wikipedia.org/wiki/Translation_(genetics)"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; line-height: 107%; text-underline: none">translated</span></a></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; background: white; line-height: 107%"> into a<span class="apple-converted-space"> </span></span><span lang="EN-US"><a title="Protein" href="http://en.wikipedia.org/wiki/Protein"><span style="font-size: 13.5pt; text-decoration: none; font-family: "Arial",sans-serif; background: white; color: windowtext; line-height: 107%; text-underline: none">protein</span></a></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; line-height: 107%"><o:p></o:p></span></p>
| + | LSRKTSIPVKDIKLTQSKAESEASLLNVSTPKSTRRSGRISSTPTTETIRGIDSDDVQDNSQLKASTQKA |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | ANLSEKHSLYTAELITVPFDSESPIRMKFTRISTPKKSKKKSNKRSEKSEATDGGFTSQIRKASNTSKNI |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | SKAKQLIEKAKALHISRSKVTEEIAIPLRRSSRHQTLPERKKLSETEDSVIIIDSSPTALKHPEKNQKKL |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | QCLNDVLGKKLNTSTKNVPGKMKVAPLFLVRKAQKAADPVPSFDESSQDTSEKSQDCDVQCKAKRDFLMS |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 9.5pt; font-family: "Arial",sans-serif; color: black"><o:p> </o:p></span></p>
| + | GLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDGCCLWHLKPPSCPLLTKFKELNTKVIDLSKCG |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 38pt; line-height: 14.3pt; text-indent: -18pt; mso-list: l0 level1 lfo1"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black; mso-fareast-font-family: Arial"><span style="mso-list: Ignore">8.<span style="font: 7pt "Times New Roman""> </span></span></span><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">What is poly A?<o:p></o:p></span></p>
| + | IALGEFSTLNSKLKSGNSAAVFMRTRKEFTEEVRNLLLEEIRWSNPEFSLKKYFPLLLKKQIEHQVLSSE |
− | <p style="background: white; margin: 4.8pt 0cm 6pt 20pt; line-height: 14.3pt"><span lang="EN-US" style="font-size: 13.5pt; font-family: "Arial",sans-serif; color: black">Poly A is long tail sequence of adenine nucleotides add it the 3’end of the pre-mRNA. This promotes export from the nucleus and translation, and protects the mRNA from degradation<o:p></o:p></span></p>
| + | CHSKQELEADVSHKETKRKLVEAENSKSKRKKPNEYSKNLEKTNRKSEELSKRNNSSGIKLDSSKDSGTE |
− | <p class="MsoNormal" style="margin: 0cm 0cm 8pt"><span lang="EN-US"><o:p><font size="2" face="맑은 고딕"> </font></o:p></span></p>
| + | DMLWTEKYQPQTASELIGNELAIKKLHSWLKDWKRRAELEERQNLKGKRDEKHEDFSGGIDFKGSSDDEE |
| + | ESRLCNTVLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKP |
| + | CFFNSYYIGKSPKKISSPKKVVTSPRKVPPPSPKSSGPKRALPPKTLANYFKVSPKPKNNEEIGMLLENN |
| + | KGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKR |
| + | PVILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVKDFVTLLTANTCDIRKSILYL |
| + | QFWIRSGGGVLEERPLTLYRGNSRNVQLVCSEHGLDNKIYPKNTKKKRVDLPKCDSGCAETLFGLKNIFS |
| + | PSEDLFSFLKHKITMKEEWHKFIQLLTEFQMRNVDFLYSNLEFILPLPVDTIPETKNFCGPSVTVDASAA |
| + | TKSMNCLARKHSEREQPLKKSQKKKQKKTLVILDDSDLFDTDLDFPDQSISLSSVSSSSNAEESKTGDEE |
| + | SKARDKGNNPETKKSIPCPPKTTAGKKCSALVSHCLNSLSEFMDNMSFLDALLTDVREQNKYGRNDFSWT |
| + | NGKVTSGLCDEFSLESNDGWTSQSSGELKAAAEALSFTKCSSAISKALETLNSCKKLGRDPTNDLTFYVS |
| + | QKRNNVYFSQSAANLDNAWKRISVIKSVFSSRSLLYVGNRQASIIEYLPTLRNICKTEKLKEQGKSKRRF |
| + | LHYFEGIHLDIPKETVNTLAADFP</pre> |
| + | |
| <p> </p> | | <p> </p> |
| + | |
| + | <p> </p> |
| + | |
| + | <p>result : http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/</p> |
| + | |
| + | <p> http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/</p> |
| + | |
| + | <p> <a href="http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/S274747_results.tar.bz2">http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/S274747_results.tar.bz2</a></p> |