imported>Galilei |
imported>Yeong Jae Kim |
Line 1: |
Line 1: |
− | <p><strong>Galileo<font color="#000000"> Galilei</font></strong><font color="#000000"> (15 February 1564<sup id="cite_ref-birthdate_1-0" class="reference"><font size="2"><span>[</span>2<span>]</span></font></sup> – 8 January 1642)<sup id="cite_ref-McTutor_0-4" class="reference"><font size="2"><span>[</span>1<span>]</span></font></sup><sup id="cite_ref-2" class="reference"><font size="2"><span>[</span>3<span>]</span></font></sup> was an Italian physicist, mathematician, astronomer, and philosopher who played a major role in the Scientific Revolution. His achievements include improvements to the telescope and consequent astronomical observations, and support for Copernicanism. Galileo has been called the "father of modern observational astronomy,"<sup id="cite_ref-3" class="reference"><font size="2"><span>[</span>4<span>]</span></font></sup> the "father of modern physics,"<sup id="cite_ref-Einstein_4-0" class="reference"><font size="2"><span>[</span>5<span>]</span></font></sup> the "father of science,"<sup id="cite_ref-Einstein_4-1" class="reference"><font size="2"><span>[</span>5<span>]</span></font></sup> and "the Father of Modern Science."<sup id="cite_ref-finocchiaro2007_5-0" class="reference"><font size="2"><span>[</span>6<span>]</span></font></sup> Stephen Hawking says, "Galileo, perhaps more than any other single person, was responsible for the birth of modern science."<sup id="cite_ref-6" class="reference"><font size="2"><span>[</span>7<span>]</span></font></sup></font></p> | + | <h1><span style="font-size:12px">1. ATAD5 ATPase family, AAA domain containing 5 [ <em>Homo sapiens</em> (human) ]</span></h1> |
− | <p><font color="#000000">The motion of uniformly accelerated objects, taught in nearly all high school and introductory college physics courses, was studied by Galileo as the subject of kinematics. His contributions to observational astronomy include the telescopic confirmation of the phases of Venus, the discovery of the four largest satellites of Jupiter (named the Galilean moons in his honour), and the observation and analysis of sunspots. Galileo also worked in applied science and technology, improving compass design.</font></p>
| |
− | <p><font color="#000000">Galileo's championing of Copernicanism was controversial within his lifetime, when a large majority of philosophers and astronomers still subscribed (at least outwardly) to the geocentric view that the Earth is at the centre of the universe. After 1610, when he began supporting heliocentrism publicly, he met with bitter opposition from some philosophers and clerics, and two of the latter eventually denounced him to the Roman Inquisition early in 1615. Although he was cleared of any offence at that time, the Catholic Church nevertheless condemned heliocentrism as "false and contrary to Scripture" in February 1616,<sup id="cite_ref-contrary_to_scripture_7-0" class="reference"><font size="2"><span>[</span>8<span>]</span></font></sup> and Galileo was warned to abandon his support for it—which he promised to do. When he later defended his views in his most famous work, <em>Dialogue Concerning the Two Chief World Systems</em>, published in 1632, he was tried by the Inquisition, found "vehemently suspect of heresy," forced to recant, and spent the rest of his life under house arrest.</font></p>
| |
| | | |
− | <p><font color="#000000"></font></p> | + | <p><span style="font-size:12px">Gene ID: 79915, updated on 26-May-2016</span></p> |
− | <h2><span class="mw-headline"><font color="#000000">Life</font></span></h2> | + | |
− | <p><font color="#000000">Galileo was born in Pisa (then part of the Duchy of Florence), Italy, the first of six children of Vincenzo Galilei, a famous lutenist and music theorist, and Giulia Ammannati. Four of their six children survived infancy, and the youngest Michelangelo (or Michelagnolo) became a noted lutenist and composer.</font></p> | + | <p><span style="font-size:12px"><i want to understand about PCNA and ATAD5 role. so pick that></span></p> |
− | <p><font color="#000000">Galileo's full name was Galileo di Vincenzo Bonaiuti de' Galilei. At the age of 8, his family moved to Florence, but he was left with Jacopo Borghini for two years.<sup id="cite_ref-McTutor_0-5" class="reference"><font size="2"><span>[</span>1<span>]</span></font></sup> He then was educated in the Camaldolese Monastery at Vallombrosa, 35 km southeast of Florence.<sup id="cite_ref-McTutor_0-6" class="reference"><font size="2"><span>[</span>1<span>]</span></font></sup> Although he seriously considered the priesthood as a young man, he enrolled for a medical degree at the University of Pisa at his father's urging. He did not complete this degree, but instead studied mathematics.<sup id="cite_ref-8" class="reference"><font size="2"><span>[</span>9<span>]</span></font></sup> In 1589, he was appointed to the chair of mathematics in Pisa. In 1591 his father died and he was entrusted with the care of his younger brother Michelagnolo. In 1592, he moved to the University of Padua, teaching geometry, mechanics, and astronomy until 1610.<sup id="cite_ref-9" class="reference"><font size="2"><span>[</span>10<span>]</span></font></sup> During this period Galileo made significant discoveries in both pure science (for example, kinematics of motion, and astronomy) and applied science (for example, strength of materials, improvement of the telescope). His multiple interests included the study of astrology, which in pre-modern disciplinary practice was seen as correlated to the studies of mathematics and astronomy.<sup id="cite_ref-10" class="reference"><font size="2"><span>[</span>11<span>]</span></font></sup></font></p> | + | |
− | <p><font color="#000000">Although a genuinely pious Roman Catholic<sup id="cite_ref-11" class="reference"><font size="2"><span>[</span>12<span>]</span></font></sup>, Galileo fathered three children out of wedlock with Marina Gamba. They had two daughters, Virginia in 1600 and Livia in 1601, and one son, Vincenzo, in 1606. Because of their illegitimate birth, their father considered the girls unmarriageable. Their only worthy alternative was the religious life. Both girls were sent to the convent of San Matteo in Arcetri and remained there for the rest of their lives.<sup id="cite_ref-daughters_unmarriageable_12-0" class="reference"><font size="2"><span>[</span>13<span>]</span></font></sup> Virginia took the name Maria Celeste upon entering the convent. She died on 2 April 1634, and is buried with Galileo at the Basilica di Santa Croce di Firenze. Livia took the name Sister Arcangela and was ill for most of her life. Vincenzo was later legitimized and married Sestilia Bocchineri.<sup id="cite_ref-13" class="reference"><font size="2"><span>[</span>14<span>]</span></font></sup></font></p>
| + | <p><span style="font-size:12px">source comes from. http://www.ncbi.nlm.nih.gov/protein/26080431?report=fasta</span></p> |
− | <p><font color="#000000">In 1610 Galileo published an account of his telescopic observations of the moons of Jupiter, using this observation to argue in favour of the sun-centered, Copernican theory of the universe against the dominant earth-centered Ptolemaic and Aristotelian theories. The next year Galileo visited Rome in order to demonstrate his telescope to the influential philosophers and mathematicians of the Jesuit Collegio Romano, and to let them see with their own eyes the reality of the four moons of Jupiter.<sup id="cite_ref-14" class="reference"><font size="2"><span>[</span>15<span>]</span></font></sup> While in Rome he was also made a member of the Accademia dei Lincei.<sup id="cite_ref-15" class="reference"><font size="2"><span>[</span>16<span>]</span></font></sup></font></p>
| + | |
− | <p><font color="#000000">In 1612, opposition arose to the Sun-centered theory of the universe which Galileo supported. In 1614, from the pulpit of the Basilica of Santa Maria Novella, Father Tommaso Caccini (1574–1648) denounced Galileo's opinions on the motion of the Earth, judging them dangerous and close to heresy. Galileo went to Rome to defend himself against these accusations, but, in 1616, Cardinal Roberto Bellarmino personally handed Galileo an admonition enjoining him neither to advocate nor teach Copernican astronomy.<sup id="cite_ref-16" class="reference"><font size="2"><span>[</span>17<span>]</span></font></sup> During 1621 and 1622 Galileo wrote his first book, <em>The Assayer</em> (<em>Il Saggiatore</em>), which was approved and published in 1623. In 1630, he returned to Rome to apply for a license to print the <em>Dialogue Concerning the Two Chief World Systems</em>, published in Florence in 1632. In October of that year, however, he was ordered to appear before the Holy Office in Rome.</font></p>
| + | <h1>ATPase family AAA domain-containing protein 5 [Homo sapiens]</h1> |
− | <p><font color="#000000">Following a papal trial in which he was found vehemently suspect of heresy, Galileo was placed under house arrest and his movements restricted by the Pope. From 1634 onward he stayed at his country house at Arcetri, outside of Florence. He went completely blind in 1638 and was suffering from a painful hernia and insomnia, so he was permitted to travel to Florence for medical advice. He continued to receive visitors until 1642, when, after suffering fever and heart palpitations, he died.<sup id="cite_ref-17" class="reference"><font size="2"><span>[</span>18<span>]</span></font></sup><sup id="cite_ref-18" class="reference"><font size="2"><span>[</span>19<span>]</span></font></sup></font></p>
| + | |
− | <p><font color="#000000" size="2"></font></p>
| + | <p>NCBI Reference Sequence: NP_079133.3</p> |
− | <h2><span class="mw-headline"><font color="#000000">Scientific methods</font></span></h2>
| + | |
− | <p><font color="#000000">Galileo made original contributions to the science of motion through an innovative combination of experiment and mathematics.<sup id="cite_ref-19" class="reference"><font size="2"><span>[</span>20<span>]</span></font></sup> More typical of science at the time were the qualitative studies of William Gilbert, on magnetism and electricity. Galileo's father, Vincenzo Galilei, a lutenist and music theorist, had performed experiments establishing perhaps the oldest known non-linear relation in physics: for a stretched string, the pitch varies as the square root of the tension.<sup id="cite_ref-20" class="reference"><font size="2"><span>[</span>21<span>]</span></font></sup> These observations lay within the framework of the Pythagorean tradition of music, well-known to instrument makers, which included the fact that subdividing a string by a whole number produces a harmonious scale. Thus, a limited amount of mathematics had long related music and physical science, and young Galileo could see his own father's observations expand on that tradition.<sup id="cite_ref-21" class="reference"><font size="2"><span>[</span>22<span>]</span></font></sup></font></p>
| + | <pre> |
− | <p><font color="#000000">Galileo is perhaps the first to clearly state that the laws of nature are mathematical. In <em>The Assayer</em> he wrote "Philosophy is written in this grand book, the universe ... It is written in the language of mathematics, and its characters are triangles, circles, and other geometric figures; ... ."<sup id="cite_ref-22" class="reference"><font size="2"><span>[</span>23<span>]</span></font></sup> His mathematical analyses are a further development of a tradition employed by late scholastic natural philosophers, which Galileo learned when he studied philosophy.<sup id="cite_ref-23" class="reference"><font size="2"><span>[</span>24<span>]</span></font></sup> Although he tried to remain loyal to the Catholic Church, his adherence to experimental results, and their most honest interpretation, led to a rejection of blind allegiance to authority, both philosophical and religious, in matters of science. In broader terms, this aided the separation of science from both philosophy and religion; a major development in human thought.</font></p>
| + | >gi|26080431|ref|NP_079133.3| ATPase family AAA domain-containing protein 5 [Homo sapiens] |
− | <p><font color="#000000">By the standards of his time, Galileo was often willing to change his views in accordance with observation. Modern philosopher of science Paul Feyerabend also noted the supposedly improper aspects of Galileo's methodology, but he argued that Galileo's methods could be justified retroactively by their results. The bulk of Feyerabend's major work, <em>Against Method</em> (1975), was devoted to an analysis of Galileo, using his astronomical research as a case study to support Feyerabend's own anarchistic theory of scientific method. As he put it: 'Aristotelians ... demanded strong empirical support while the Galileans were content with far-reaching, unsupported and partially refuted theories. I do not criticize them for that; on the contrary, I favour Niels Bohr's "this is not crazy enough."'<sup id="cite_ref-24" class="reference"><font size="2"><span>[</span>25<span>]</span></font></sup> In order to perform his experiments, Galileo had to set up standards of length and time, so that measurements made on different days and in different laboratories could be compared in a reproducible fashion.</font></p>
| + | MVGVLAMAAAAAPPPVKDCEIEPCKKRKKDDDTSTCKTITKYLSPLGKTRDRVFAPPKPSNILDYFRKTS |
− | <p><font color="#000000">Galileo showed a remarkably modern appreciation for the proper relationship between mathematics, theoretical physics, and experimental physics. He understood the parabola, both in terms of conic sections and in terms of the ordinate (y) varying as the square of the abscissa (x). Galilei further asserted that the parabola was the theoretically ideal trajectory of a uniformly accelerated projectile in the absence of friction and other disturbances. He conceded that there are limits to the validity of this theory, noting on theoretical grounds that a projectile trajectory of a size comparable to that of the Earth could not possibly be a parabola,<sup id="cite_ref-25" class="reference"><font size="2"><span>[</span>26<span>]</span></font></sup> but he nevertheless maintained that for distances up to the range of the artillery of his day, the deviation of a projectile's trajectory from a parabola would only be very slight.<sup id="cite_ref-26" class="reference"><font size="2"><span>[</span>27<span>]</span></font></sup> Thirdly, he recognized that his experimental data would never agree exactly with any theoretical or mathematical form, because of the imprecision of measurement, irreducible friction, and other factors.</font></p>
| + | PTNEKTQLGKECKIKSPESVPVDSNKDCTTPLEMFSNVEFKKKRKRVNLSHQLNNIKTENEAPIEISSDD |
− | <p><font color="#000000">According to Stephen Hawking, Galileo probably bears more of the responsibility for the birth of modern science than anybody else,<sup id="cite_ref-Hawking_galileo_27-0" class="reference"><font size="2"><span>[</span>28<span>]</span></font></sup> and Albert Einstein called him the father of modern science.<sup id="cite_ref-father_of_science_Einstein_28-0" class="reference"><font size="2"><span>[</span>29<span>]</span></font></sup></font></p>
| + | SKEDYSLNNDFVESSTSVLRYKKQVEVLAENIQDTKSQPNTMTSLQNSKKVNPKQGTTKNDFKKLRKRKC |
− | <p><font color="#000000" size="2"></font></p>
| + | RDVVDLSESLPLAEELNLLKKDGKDTKQMENTTSHANSRDNVTEAAQLNDSIITVSYEEFLKSHKENKVE |
− | <h2><span class="mw-headline"><font color="#000000">Astronomy</font></span></h2>
| + | EIPDSTMSICVPSETVDEIVKSGYISESENSEISQQVRFKTVTVLAQVHPIPPKKTGKIPRIFLKQKQFE |
− | <p><font color="#000000"></font></p>
| + | MENSLSDPENEQTVQKRKSNVVIQEEELELAVLEAGSSEAVKPKCTLEERQQFMKAFRQPASDALKNGVK |
− | <h3><span class="mw-headline"><font color="#000000">Contributions</font></span></h3>
| + | KSSDKQKDLNEKCLYEVGRDDNSKKIMENSGIQMVSKNGNLQLHTDKGSFLKEKNKKLKKKNKKTLDTGA |
− | <div class="thumb tright">
| + | IPGKNREGNTQKKETTFFLKEKQYQNRMSLRQRKTEFFKSSTLFNNESLVYEDIANDDLLKVSSLCNNNK |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="276" src="http://upload.wikimedia.org/wikipedia/commons/thumb/8/87/Galileo.script.arp.600pix.jpg.jpg/180px-Galileo.script.arp.600pix.jpg.jpg" /> </font>
| + | LSRKTSIPVKDIKLTQSKAESEASLLNVSTPKSTRRSGRISSTPTTETIRGIDSDDVQDNSQLKASTQKA |
− | <div class="thumbcaption">
| + | ANLSEKHSLYTAELITVPFDSESPIRMKFTRISTPKKSKKKSNKRSEKSEATDGGFTSQIRKASNTSKNI |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| + | SKAKQLIEKAKALHISRSKVTEEIAIPLRRSSRHQTLPERKKLSETEDSVIIIDSSPTALKHPEKNQKKL |
− | <font color="#000000">It was on this page that Galileo first noted an observation of the moons of Jupiter. This observation upset the notion that all celestial bodies must revolve around the Earth. Galileo published a full description in <em>Sidereus Nuncius</em> in March 1610</font></div>
| + | QCLNDVLGKKLNTSTKNVPGKMKVAPLFLVRKAQKAADPVPSFDESSQDTSEKSQDCDVQCKAKRDFLMS |
− | </div>
| + | GLPDLLKRQIAKKAAALDVYNAVSTSFQRVVHVQQKDDGCCLWHLKPPSCPLLTKFKELNTKVIDLSKCG |
− | </div>
| + | IALGEFSTLNSKLKSGNSAAVFMRTRKEFTEEVRNLLLEEIRWSNPEFSLKKYFPLLLKKQIEHQVLSSE |
− | <div class="thumb tright">
| + | CHSKQELEADVSHKETKRKLVEAENSKSKRKKPNEYSKNLEKTNRKSEELSKRNNSSGIKLDSSKDSGTE |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="135" src="http://upload.wikimedia.org/wikipedia/commons/thumb/d/d1/Phases-of-Venus.svg/180px-Phases-of-Venus.svg.png" /> </font>
| + | DMLWTEKYQPQTASELIGNELAIKKLHSWLKDWKRRAELEERQNLKGKRDEKHEDFSGGIDFKGSSDDEE |
− | <div class="thumbcaption">
| + | ESRLCNTVLITGPTGVGKTAAVYACAQELGFKIFEVNASSQRSGRQILSQLKEATQSHQVDKQGVNSQKP |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| + | CFFNSYYIGKSPKKISSPKKVVTSPRKVPPPSPKSSGPKRALPPKTLANYFKVSPKPKNNEEIGMLLENN |
− | <font color="#000000">The phases of Venus, observed by Galileo in 1610</font></div>
| + | KGIKNSFEQKQITQTKSTNATNSNVKDVGAEEPSRKNATSLILFEEVDVIFDEDAGFLNAIKTFMATTKR |
− | </div>
| + | PVILTTSDPTFSLMFDGCFEEIKFSTPSLLNVASYLQMICLTENFRTDVKDFVTLLTANTCDIRKSILYL |
− | </div>
| + | QFWIRSGGGVLEERPLTLYRGNSRNVQLVCSEHGLDNKIYPKNTKKKRVDLPKCDSGCAETLFGLKNIFS |
− | <p><font color="#000000">Based only on uncertain descriptions of the first practical telescope, invented by Hans Lippershey in the Netherlands in 1608, Galileo, in the following year, made a telescope with about 3x magnification. He later made others with up to about 30x magnification.<sup id="cite_ref-29" class="reference"><font size="2"><span>[</span>30<span>]</span></font></sup> With this improved device he could see magnified, upright images on the earth – it was what is now known as a terrestrial telescope, or spyglass. He could also use it to observe the sky; for a time he was one of those who could construct telescopes good enough for that purpose. On 25 August 1609, he demonstrated his first telescope to Venetian lawmakers. His telescopes were a profitable sideline. He could sell them to merchants who found them useful both at sea and as items of trade. He published his initial telescopic astronomical observations in March 1610 in a brief treatise entitled <em>Sidereus Nuncius</em> (<em>Starry Messenger</em>).</font></p>
| + | PSEDLFSFLKHKITMKEEWHKFIQLLTEFQMRNVDFLYSNLEFILPLPVDTIPETKNFCGPSVTVDASAA |
− | <p><font color="#000000">On 7 January 1610 Galileo observed with his telescope what he described at the time as "three fixed stars, totally invisible<sup id="cite_ref-invisible_30-0" class="reference"><font size="2"><span>[</span>31<span>]</span></font></sup> by their smallness," all close to Jupiter, and lying on a straight line through it.<sup id="cite_ref-jupiter.27s_moons_31-0" class="reference"><font size="2"><span>[</span>32<span>]</span></font></sup> Observations on subsequent nights showed that the positions of these "stars" relative to Jupiter were changing in a way that would have been inexplicable if they had really been fixed stars. On 10 January Galileo noted that one of them had disappeared, an observation which he attributed to its being hidden behind Jupiter. Within a few days he concluded that they were orbiting Jupiter:<sup id="cite_ref-moonconclusion_32-0" class="reference"><font size="2"><span>[</span>33<span>]</span></font></sup> He had discovered three of Jupiter's four largest satellites (moons): Io, Europa, and Callisto. He discovered the fourth, Ganymede, on 13 January. Galileo named the four satellites he had discovered <em>Medicean stars</em>, in honour of his future patron, Cosimo II de' Medici, Grand Duke of Tuscany, and Cosimo's three brothers.<sup id="cite_ref-medicean_stars_33-0" class="reference"><font size="2"><span>[</span>34<span>]</span></font></sup> Later astronomers, however, renamed them the <em>Galilean satellites</em> in honour of Galileo himself.</font></p>
| + | TKSMNCLARKHSEREQPLKKSQKKKQKKTLVILDDSDLFDTDLDFPDQSISLSSVSSSSNAEESKTGDEE |
− | <p><font color="#000000">A planet with smaller planets orbiting it did not conform to the principles of Aristotelian Cosmology, which held that all heavenly bodies should circle the Earth,<sup id="cite_ref-34" class="reference"><font size="2"><span>[</span>35<span>]</span></font></sup> and many astronomers and philosophers initially refused to believe that Galileo could have discovered such a thing.<sup id="cite_ref-scepticism_35-0" class="reference"><font size="2"><span>[</span>36<span>]</span></font></sup> His observations were confirmed by the observatory of Christopher Clavius and he received a hero's welcome when he visited Rome in 1611<sup id="cite_ref-36" class="reference"><font size="2"><span>[</span>37<span>]</span></font></sup></font></p>
| + | SKARDKGNNPETKKSIPCPPKTTAGKKCSALVSHCLNSLSEFMDNMSFLDALLTDVREQNKYGRNDFSWT |
− | <p><font color="#000000">Galileo continued to observe the satellites over the next eighteen months, and by mid 1611 he had obtained remarkably accurate estimates for their periods—a feat which Kepler had believed impossible.<sup id="cite_ref-periods_37-0" class="reference"><font size="2"><span>[</span>38<span>]</span></font></sup></font></p>
| + | NGKVTSGLCDEFSLESNDGWTSQSSGELKAAAEALSFTKCSSAISKALETLNSCKKLGRDPTNDLTFYVS |
− | <p><font color="#000000">From September 1610, Galileo observed that Venus exhibited a full set of phases similar to that of the Moon. The heliocentric model of the solar system developed by Nicolaus Copernicus predicted that all phases would be visible since the orbit of Venus around the Sun would cause its illuminated hemisphere to face the Earth when it was on the opposite side of the Sun and to face away from the Earth when it was on the Earth-side of the Sun. On the other hand, in Ptolemy's geocentric model it was impossible for any of the planets' orbits to intersect the spherical shell carrying the Sun. Traditionally the orbit of Venus was placed entirely on the near side of the Sun, where it could exhibit only crescent and new phases. It was, however, also possible to place it entirely on the far side of the Sun, where it could exhibit only gibbous and full phases. After Galileo's telescopic observations of the crescent, gibbous and full phases of Venus, therefore, this Ptolemaic model became untenable. Thus in the early 17th century as a result of his discovery the great majority of astronomers converted to one of the various geo-heliocentric planetary models<sup id="cite_ref-38" class="reference"><font size="2"><span>[</span>39<span>]</span></font></sup>, such as the Tychonic, Capellan and Extended Capellan models<sup id="cite_ref-39" class="reference"><font size="2"><span>[</span>40<span>]</span></font></sup>, each either with or without a daily rotating Earth. These all had the virtue of explaining the phases of Venus without the vice of the 'refutation' of full heliocentrism’s prediction of stellar parallax. Galileo’s discovery of the phases of Venus was thus arguably his most empirically practically influential contribution to the two-stage transition from full geocentrism to full heliocentrism via geo-heliocentrism.</font></p>
| + | QKRNNVYFSQSAANLDNAWKRISVIKSVFSSRSLLYVGNRQASIIEYLPTLRNICKTEKLKEQGKSKRRF |
− | <p><font color="#000000">Galileo also observed the planet Saturn, and at first mistook its rings for planets, thinking it was a three-bodied system. When he observed the planet later, Saturn's rings were directly oriented at Earth, causing him to think that two of the bodies had disappeared. The rings reappeared when he observed the planet in 1616, further confusing him.<sup id="cite_ref-40" class="reference"><font size="2"><span>[</span>41<span>]</span></font></sup></font></p>
| + | LHYFEGIHLDIPKETVNTLAADFP</pre> |
− | <p><font color="#000000">Galileo was one of the first Europeans to observe sunspots, although Kepler had unwittingly observed one in 1607, but mistook it for a transit of Mercury. He also reinterpreted a sunspot observation from the time of Charlemagne, which formerly had been attributed (impossibly) to a transit of Mercury. The very existence of sunspots showed another difficulty with the unchanging perfection of the heavens posited by orthodox Aristotelian celestial physics, but their regular periodic transits also confirmed the dramatic novel prediction of Kepler's Aristotelian celestial dynamics in his 1609 <em>Astronomia Nova</em> that the sun rotates, which was the first successful novel prediction of post-spherist celestial physics.<sup id="cite_ref-41" class="reference"><font size="2"><span>[</span>42<span>]</span></font></sup> And the annual variations in sunspots' motions, discovered by Francesco Sizzi and others in 1612–1613,<sup id="cite_ref-42" class="reference"><font size="2"><span>[</span>43<span>]</span></font></sup> provided a powerful argument against both the Ptolemaic system and the geoheliocentric system of Tycho Brahe.<sup id="cite_ref-sunspot_argument_43-0" class="reference"><font size="2"><span>[</span>44<span>]</span></font></sup> For the seasonal variation refuted all non-geo-rotational geostatic planetary models such as the Ptolemaic pure geocentric model and the Tychonic geoheliocentric model in which the Sun orbits the Earth daily, whereby the variation should appear daily but does not. But it was explicable by all geo-rotational systems such as Longomontanus's semi-Tychonic geo-heliocentric model, Capellan and extended Capellan geo-heliocentric models with a daily rotating Earth, and the pure heliocentric model. A dispute over priority in the discovery of sunspots, and in their interpretation, led Galileo to a long and bitter feud with the Jesuit Christoph Scheiner; in fact, there is little doubt that both of them were beaten by David Fabricius and his son Johannes, looking for confirmation of Kepler's prediction of the sun's rotation. Scheiner quickly adopted Kepler's 1615 proposal of the modern telescope design, which gave larger magnification at the cost of inverted images; Galileo apparently never changed to Kepler's design.</font></p>
| + | |
− | <p><font color="#000000">Galileo was the first to report lunar mountains and craters, whose existence he deduced from the patterns of light and shadow on the Moon's surface. He even estimated the mountains' heights from these observations. This led him to the conclusion that the Moon was "rough and uneven, and just like the surface of the Earth itself," rather than a perfect sphere as Aristotle had claimed. Galileo observed the Milky Way, previously believed to be nebulous, and found it to be a multitude of stars packed so densely that they appeared to be clouds from Earth. He located many other stars too distant to be visible with the naked eye. Galileo also observed the planet Neptune in 1612, but did not realize that it was a planet and took no particular notice of it. It appears in his notebooks as one of many unremarkable dim stars.</font></p>
| + | <p> </p> |
− | <p><font color="#000000"></font></p>
| + | |
− | <h3><span class="mw-headline"><font color="#000000">Controversy over comets and <em>The Assayer</em></font></span></h3>
| + | <p> </p> |
− | <div class="rellink noprint relarticle mainarticle"><font color="#000000">Main article: The Assayer</font></div>
| + | |
− | <p><font color="#000000">In 1619, Galileo became embroiled in a controversy with Father Orazio Grassi, professor of mathematics at the Jesuit Collegio Romano. It began as a dispute over the nature of comets, but by the time Galileo had published <em>The Assayer</em> (<em>Il Saggiatore</em>) in 1623, his last salvo in the dispute, it had become a much wider argument over the very nature of Science itself. Because <em>The Assayer</em> contains such a wealth of Galileo's ideas on how Science should be practised, it has been referred to as his scientific manifesto.<sup id="cite_ref-scientific_manifesto_44-0" class="reference"><font size="2"><span>[</span>45<span>]</span></font></sup></font></p>
| + | <p>result : http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/</p> |
− | <p><font color="#000000">Early in 1619, Father Grassi had anonymously published a pamphlet, <em>An Astronomical Disputation on the Three Comets of the Year 1618</em> ,<sup id="cite_ref-disputatio_45-0" class="reference"><font size="2"><span>[</span>46<span>]</span></font></sup> which discussed the nature of a comet that had appeared late in November of the previous year. Grassi concluded that the comet was a fiery body which had moved along a segment of a great circle at a constant distance from the earth,<sup id="cite_ref-grassi_great_circle_46-0" class="reference"><font size="2"><span>[</span>47<span>]</span></font></sup> and that it had been located well beyond the moon.</font></p>
| + | |
− | <p><font color="#000000">Grassi's arguments and conclusions were criticized in a subsequent article, <em>Discourse on the Comets</em> ,<sup id="cite_ref-discourse_on_comets_47-0" class="reference"><font size="2"><span>[</span>48<span>]</span></font></sup> published under the name of one of Galileo's disciples, a Florentine lawyer named Mario Guiducci, although it had been largely written by Galileo himself.<sup id="cite_ref-authorship_of_discourse_48-0" class="reference"><font size="2"><span>[</span>49<span>]</span></font></sup> Galileo and Guiducci offered no definitive theory of their own on the nature of comets,<sup id="cite_ref-criticism_of_previous_theories_49-0" class="reference"><font size="2"><span>[</span>50<span>]</span></font></sup> although they did present some tentative conjectures which we now know to be mistaken.</font></p>
| + | <p> http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/</p> |
− | <p><font color="#000000">In its opening passage, Galileo and Guiducci's <em>Discourse</em> gratuitously insulted the Jesuit Christopher Scheiner,<sup id="cite_ref-Scheiner_insult_50-0" class="reference"><font size="2"><span>[</span>51<span>]</span></font></sup> and various uncomplimentary remarks about the professors of the Collegio Romano were scattered throughout the work.<sup id="cite_ref-uncomplimentary_remark_51-0" class="reference"><font size="2"><span>[</span>52<span>]</span></font></sup> The Jesuits were offended,<sup id="cite_ref-jesuits_offended_52-0" class="reference"><font size="2"><span>[</span>53<span>]</span></font></sup> and Grassi soon replied with a polemical tract of his own, <em>The Astronomical and Philosophical Balance</em> ,<sup id="cite_ref-astronomical_balance_53-0" class="reference"><font size="2"><span>[</span>54<span>]</span></font></sup> under the pseudonym Lothario Sarsio Sigensano,<sup id="cite_ref-54" class="reference"><font size="2"><span>[</span>55<span>]</span></font></sup> purporting to be one of his own pupils.</font></p>
| + | |
− | <p><font color="#000000"><em>The Assayer</em> was Galileo's devastating reply to the <em>Astronomical Balance</em>.<sup id="cite_ref-the_assayer_55-0" class="reference"><font size="2"><span>[</span>56<span>]</span></font></sup> It has been widely regarded as a masterpiece of polemical literature,<sup id="cite_ref-masterpiece_of_polemics_56-0" class="reference"><font size="2"><span>[</span>57<span>]</span></font></sup> in which "Sarsi's" arguments are subjected to withering scorn.<sup id="cite_ref-withering_scorn_57-0" class="reference"><font size="2"><span>[</span>58<span>]</span></font></sup> It was greeted with wide acclaim, and particularly pleased the new pope, Urban VIII, to whom it had been dedicated.<sup id="cite_ref-assayer_success_58-0" class="reference"><font size="2"><span>[</span>59<span>]</span></font></sup></font></p>
| + | <p> <a href="http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/S274747_results.tar.bz2">http://zhanglab.ccmb.med.umich.edu/I-TASSER/output/S274747/S274747_results.tar.bz2</a></p> |
− | <p><font color="#000000">Galileo's dispute with Grassi permanently alienated many of the Jesuits who had previously been sympathetic to his ideas,<sup id="cite_ref-jesuit_alienation_59-0" class="reference"><font size="2"><span>[</span>60<span>]</span></font></sup> and Galileo and his friends were convinced that these Jesuits were responsible for bringing about his later condemnation.<sup id="cite_ref-jesuits_responsible_60-0" class="reference"><font size="2"><span>[</span>61<span>]</span></font></sup> The evidence for this is at best equivocal, however.<sup id="cite_ref-evidence_of_jesuits_61-0" class="reference"><font size="2"><span>[</span>62<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000" size="2"></font></p>
| |
− | <h3><span class="mw-headline"><font color="#000000">Galileo, Kepler and theories of tides</font></span></h3>
| |
− | <p><font color="#000000">Cardinal Bellarmine had written in 1615 that the Copernican system could not be defended without "a true physical demonstration that the sun does not circle the earth but the earth circles the sun."<sup id="cite_ref-62" class="reference"><font size="2"><span>[</span>63<span>]</span></font></sup> Galileo considered his theory of the tides to provide the required physical proof of the motion of the earth. This theory was so important to Galileo that he originally intended to entitle his <em>Dialogue on the Two Chief World Systems</em> the <em>Dialogue on the Ebb and Flow of the Sea</em>.<sup id="cite_ref-63" class="reference"><font size="2"><span>[</span>64<span>]</span></font></sup> For Galileo, the tides were caused by the sloshing back and forth of water in the seas as a point on the Earth's surface speeded up and slowed down because of the Earth's rotation on its axis and revolution around the Sun. Galileo circulated his first account of the tides in 1616, addressed to Cardinal Orsini.<sup id="cite_ref-64" class="reference"><font size="2"><span>[</span>65<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">If this theory were correct, there would be only one high tide per day. Galileo and his contemporaries were aware of this inadequacy because there are two daily high tides at Venice instead of one, about twelve hours apart. Galileo dismissed this anomaly as the result of several secondary causes, including the shape of the sea, its depth, and other factors.<sup id="cite_ref-65" class="reference"><font size="2"><span>[</span>66<span>]</span></font></sup> Against the assertion that Galileo was deceptive in making these arguments, Albert Einstein expressed the opinion that Galileo developed his "fascinating arguments" and accepted them uncritically out of a desire for physical proof of the motion of the Earth.<sup id="cite_ref-66" class="reference"><font size="2"><span>[</span>67<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">Galileo dismissed as a "useless fiction" the idea, held by his contemporary Johannes Kepler, that the moon caused the tides.<sup id="cite_ref-67" class="reference"><font size="2"><span>[</span>68<span>]</span></font></sup> Galileo also refused to accept Kepler's elliptical orbits of the planets,<sup id="cite_ref-68" class="reference"><font size="2"><span>[</span>69<span>]</span></font></sup> considering the circle the "perfect" shape for planetary orbits.</font></p>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="260" src="http://upload.wikimedia.org/wikipedia/commons/thumb/4/48/Galilee.jpg/180px-Galilee.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">Galileo Galilei. Portrait in crayon by Leoni.</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="135" src="http://upload.wikimedia.org/wikipedia/commons/thumb/7/7d/Galileo_telescope_replica.jpg/180px-Galileo_telescope_replica.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">A replica of the earliest surviving telescope attributed to Galileo Galilei, on display at the Griffith Observatory.</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Technology</font></span></h2>
| |
− | <p><font color="#000000">Galileo made a number of contributions to what is now known as technology, as distinct from pure physics, and suggested others. This is not the same distinction as made by Aristotle, who would have considered all Galileo's physics as <em>techne</em> or useful knowledge, as opposed to <em>episteme</em>, or philosophical investigation into the causes of things. Between 1595–1598, Galileo devised and improved a <em>Geometric and Military Compass</em> suitable for use by gunners and surveyors. This expanded on earlier instruments designed by Niccolò Tartaglia and Guidobaldo del Monte. For gunners, it offered, in addition to a new and safer way of elevating cannons accurately, a way of quickly computing the charge of gunpowder for cannonballs of different sizes and materials. As a geometric instrument, it enabled the construction of any regular polygon, computation of the area of any polygon or circular sector, and a variety of other calculations. About 1593, Galileo constructed a thermometer, using the expansion and contraction of air in a bulb to move water in an attached tube.</font></p>
| |
− | <p><font color="#000000">In 1609, Galileo was, along with Englishman Thomas Harriot and others, among the first to use a refracting telescope as an instrument to observe stars, planets or moons. The name "telescope" was coined for Galileo's instrument by a Greek mathematician, Giovanni Demisiani,<sup id="cite_ref-69" class="reference"><font size="2"><span>[</span>70<span>]</span></font></sup> at a banquet held in 1611 by Prince Federico Cesi to make Galileo a member of his Accademia dei Lincei.<sup id="cite_ref-70" class="reference"><font size="2"><span>[</span>71<span>]</span></font></sup> The name was derived from the Greek <em>tele</em> = 'far' and <em>skopein</em> = 'to look or see'. In 1610, he used a telescope at close range to magnify the parts of insects.<sup id="cite_ref-telescope_microscope_71-0" class="reference"><font size="2"><span>[</span>72<span>]</span></font></sup> By 1624 he had perfected<sup id="cite_ref-microscope_perfection_72-0" class="reference"><font size="2"><span>[</span>73<span>]</span></font></sup> a compound microscope. He gave one of these instruments to Cardinal Zollern in May of that year for presentation to the Duke of Bavaria,<sup id="cite_ref-Zollern_microscope_73-0" class="reference"><font size="2"><span>[</span>74<span>]</span></font></sup> and in September he sent another to Prince Cesi.<sup id="cite_ref-Cesi_microscope_74-0" class="reference"><font size="2"><span>[</span>75<span>]</span></font></sup> The Linceans played a role again in naming the "microscope" a year later when fellow academy member Giovanni Faber coined the word for Galileo's invention from the Greek words <em>μικρόν</em> (<em>micron</em>) meaning "small," and <em>σκοπεῖν</em> (<em>skopein</em>) meaning "to look at." The word was meant to be analogous with "telescope."<sup id="cite_ref-75" class="reference"><font size="2"><span>[</span>76<span>]</span></font></sup><sup id="cite_ref-76" class="reference"><font size="2"><span>[</span>77<span>]</span></font></sup> Illustrations of insects made using one of Galileo's microscopes, and published in 1625, appear to have been the first clear documentation of the use of a compound microscope.<sup id="cite_ref-microscope_use_77-0" class="reference"><font size="2"><span>[</span>78<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">In 1612, having determined the orbital periods of Jupiter's satellites, Galileo proposed that with sufficiently accurate knowledge of their orbits one could use their positions as a universal clock, and this would make possible the determination of longitude. He worked on this problem from time to time during the remainder of his life; but the practical problems were severe. The method was first successfully applied by Giovanni Domenico Cassini in 1681 and was later used extensively for large land surveys; this method, for example, was used by Lewis and Clark. For sea navigation, where delicate telescopic observations were more difficult, the longitude problem eventually required development of a practical portable marine chronometer, such as that of John Harrison.</font></p>
| |
− | <p><font color="#000000">In his last year, when totally blind, he designed an escapement mechanism for a pendulum clock, a vectorial model of which may be seen here. The first fully operational pendulum clock was made by Christiaan Huygens in the 1650s. Galilei created sketches of various inventions, such as a candle and mirror combination to reflect light throughout a building, an automatic tomato picker, a pocket comb that doubled as an eating utensil, and what appears to be a ballpoint pen.</font></p>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Physics</font></span></h2>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="145" src="http://upload.wikimedia.org/wikipedia/commons/thumb/9/95/Tito_Lessi_-_Galileo_and_Viviani.jpg/180px-Tito_Lessi_-_Galileo_and_Viviani.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000"><em>Galileo e Viviani</em>, 1892, Tito Lessi</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">Galileo's theoretical and experimental work on the motions of bodies, along with the largely independent work of Kepler and René Descartes, was a precursor of the classical mechanics developed by Sir Isaac Newton.</font></p>
| |
− | <p><font color="#000000">A biography by Galileo's pupil Vincenzo Viviani stated that Galileo had dropped balls of the same material, but different masses, from the Leaning Tower of Pisa to demonstrate that their time of descent was independent of their mass.<sup id="cite_ref-78" class="reference"><font size="2"><span>[</span>79<span>]</span></font></sup> This was contrary to what Aristotle had taught: that heavy objects fall faster than lighter ones, in direct proportion to weight.<sup id="cite_ref-79" class="reference"><font size="2"><span>[</span>80<span>]</span></font></sup> While this story has been retold in popular accounts, there is no account by Galileo himself of such an experiment, and it is generally accepted by historians that it was at most a thought experiment which did not actually take place.<sup id="cite_ref-80" class="reference"><font size="2"><span>[</span>81<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">In his 1638 <em>Discorsi</em> Galileo's character Salviati, widely regarded as largely Galileo's spokesman, held that all unequal weights would fall with the same finite speed in a vacuum. But this had previously been proposed by Lucretius<sup id="cite_ref-81" class="reference"><font size="2"><span>[</span>82<span>]</span></font></sup> and Simon Stevin.<sup id="cite_ref-82" class="reference"><font size="2"><span>[</span>83<span>]</span></font></sup> Salviati also held it could be experimentally demonstrated by the comparison of pendulum motions in air with bobs of lead and of cork which had different weight but which were otherwise similar.</font></p>
| |
− | <p><font color="#000000">Galileo proposed that a falling body would fall with a uniform acceleration, as long as the resistance of the medium through which it was falling remained negligible, or in the limiting case of its falling through a vacuum.<sup id="cite_ref-83" class="reference"><font size="2"><span>[</span>84<span>]</span></font></sup> He also derived the correct kinematical law for the distance travelled during a uniform acceleration starting from rest—namely, that it is proportional to the square of the elapsed time ( <em>d</em> ∝ <em>t</em><sup><font size="2"> 2</font></sup> ).<sup id="cite_ref-84" class="reference"><font size="2"><span>[</span>85<span>]</span></font></sup> However, in neither case were these discoveries entirely original. The time-squared law for uniformly accelerated change was already known to Nicole Oresme in the 14th century,<sup id="cite_ref-85" class="reference"><font size="2"><span>[</span>86<span>]</span></font></sup> and Domingo de Soto, in the 16th, had suggested that bodies falling through a homogeneous medium would be uniformly accelerated.<sup id="cite_ref-86" class="reference"><font size="2"><span>[</span>87<span>]</span></font></sup> Galileo expressed the time-squared law using geometrical constructions and mathematically precise words, adhering to the standards of the day. (It remained for others to re-express the law in algebraic terms). He also concluded that objects <em>retain their velocity</em> unless a force—often friction—acts upon them, refuting the generally accepted Aristotelian hypothesis that objects "naturally" slow down and stop unless a force acts upon them (philosophical ideas relating to inertia had been proposed by Ibn al-Haytham centuries earlier, as had Jean Buridan, and according to Joseph Needham, Mo Tzu had proposed it centuries before either of them, but this was the first time that it had been mathematically expressed, verified experimentally, and introduced the idea of frictional force, the key breakthrough in validating inertia). Galileo's Principle of Inertia stated: "A body moving on a level surface will continue in the same direction at constant speed unless disturbed." This principle was incorporated into Newton's laws of motion (first law).</font></p>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="193" src="http://upload.wikimedia.org/wikipedia/commons/thumb/7/73/Pisa.Duomo.dome.Riminaldi01.jpg/180px-Pisa.Duomo.dome.Riminaldi01.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">Dome of the cathedral of Pisa with the "lamp of Galileo"</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">Galileo also claimed (incorrectly) that a pendulum's swings always take the same amount of time, independently of the amplitude. That is, that a simple pendulum is isochronous. It is popularly believed that he came to this conclusion by watching the swings of the bronze chandelier in the cathedral of Pisa, using his pulse to time it. It appears however, that he conducted no experiments because the claim is true only of infinitesimally small swings as discovered by Christian Huygens. Galileo's son, Vincenzo, sketched a clock based on his father's theories in 1642. The clock was never built and, because of the large swings required by its verge escapement, would have been a poor timekeeper. (See Technology above.)</font></p>
| |
− | <p><font color="#000000">In 1638 Galileo described an experimental method to measure the speed of light by arranging that two observers, each having lanterns equipped with shutters, observe each other's lanterns at some distance. The first observer opens the shutter of his lamp, and, the second, upon seeing the light, immediately opens the shutter of his own lantern. The time between the first observer's opening his shutter and seeing the light from the second observer's lamp indicates the time it takes light to travel back and forth between the two observers. Galileo reported that when he tried this at a distance of less than a mile, he was unable to determine whether or not the light appeared instantaneously.<sup id="cite_ref-87" class="reference"><font size="2"><span>[</span>88<span>]</span></font></sup> Sometime between Galileo's death and 1667, the members of the Florentine <em>Accademia del Cimento</em> repeated the experiment over a distance of about a mile and obtained a similarly inconclusive result.<sup id="cite_ref-88" class="reference"><font size="2"><span>[</span>89<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">Galileo is lesser known for, yet still credited with, being one of the first to understand sound frequency. By scraping a chisel at different speeds, he linked the pitch of the sound produced to the spacing of the chisel's skips, a measure of frequency.</font></p>
| |
− | <p><font color="#000000">In his 1632 Dialogue Galileo presented a physical theory to account for tides, based on the motion of the Earth. If correct, this would have been a strong argument for the reality of the Earth's motion. In fact, the original title for the book described it as a dialogue on the tides; the reference to tides was removed by order of the Inquisition. His theory gave the first insight into the importance of the shapes of ocean basins in the size and timing of tides; he correctly accounted, for instance, for the negligible tides halfway along the Adriatic Sea compared to those at the ends. As a general account of the cause of tides, however, his theory was a failure. Kepler and others correctly associated the Moon with an influence over the tides, based on empirical data; a proper physical theory of the tides, however, was not available until Newton.</font></p>
| |
− | <p><font color="#000000">Galileo also put forward the basic principle of relativity, that the laws of physics are the same in any system that is moving at a constant speed in a straight line, regardless of its particular speed or direction. Hence, there is no absolute motion or absolute rest. This principle provided the basic framework for Newton's laws of motion and is central to Einstein's special theory of relativity.</font></p>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Mathematics</font></span></h2>
| |
− | <p><font color="#000000">While Galileo's application of mathematics to experimental physics was innovative, his mathematical methods were the standard ones of the day. The analysis and proofs relied heavily on the Eudoxian theory of proportion, as set forth in the fifth book of Euclid's Elements. This theory had become available only a century before, thanks to accurate translations by Tartaglia and others; but by the end of Galileo's life it was being superseded by the algebraic methods of Descartes.</font></p>
| |
− | <p><font color="#000000">Galileo produced one piece of original and even prophetic work in mathematics: Galileo's paradox, which shows that there are as many perfect squares as there are whole numbers, even though most numbers are not perfect squares. Such seeming contradictions were brought under control 250 years later in the work of Georg Cantor.</font></p>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Church controversy</font></span></h2>
| |
− | <div class="rellink noprint relarticle mainarticle"><font color="#000000">Main article: Galileo affair</font></div>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="180" height="137" src="http://upload.wikimedia.org/wikipedia/commons/thumb/8/88/Galileo_facing_the_Roman_Inquisition.jpg/180px-Galileo_facing_the_Roman_Inquisition.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">Cristiano Banti's 1857 painting <em>Galileo facing the Roman Inquisition</em></font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">Western Christian biblical references Psalm 93:1, Psalm 96:10, and 1 Chronicles 16:30 include (depending on translation) text stating that "the world is firmly established, it cannot be moved." In the same tradition, Psalm 104:5 says, "the LORD set the earth on its foundations; it can never be moved." Further, Ecclesiastes 1:5 states that "And the sun rises and sets and returns to its place" etc.<sup id="cite_ref-Bellarmine_quote_89-0" class="reference"><font size="2"><span>[</span>90<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">Galileo defended heliocentrism, and claimed it was not contrary to those Scripture passages. He took Augustine's position on Scripture: not to take every passage literally, particularly when the scripture in question is a book of poetry and songs, not a book of instructions or history. The writers of the Scripture wrote from the perspective of the terrestrial world, and from that vantage point the sun does rise and set.</font></p>
| |
− | <p><font color="#000000">By 1616 the attacks on the ideas of Copernicus had reached a head, and Galileo went to Rome to try to persuade the Church authorities not to ban his ideas. In the end, Cardinal Bellarmine, acting on directives from the Inquisition, delivered him an order not to "hold or defend" the idea that the Earth moves and the Sun stands still at the centre. The decree did not prevent Galileo from discussing heliocentrism hypothesis (thus maintaining a facade of separation between science and the church). For the next several years Galileo stayed well away from the controversy. He revived his project of writing a book on the subject, encouraged by the election of Cardinal Barberini as Pope Urban VIII in 1623. Barberini was a friend and admirer of Galileo, and had opposed the condemnation of Galileo in 1616. The book, <em>Dialogue Concerning the Two Chief World Systems</em>, was published in 1632, with formal authorization from the Inquisition and papal permission.</font></p>
| |
− | <p><font color="#000000">Pope Urban VIII personally asked Galileo to give arguments for and against heliocentrism in the book, and to be careful not to advocate heliocentrism. He made another request, that his own views on the matter be included in Galileo's book. Only the latter of those requests was fulfilled by Galileo. Whether unknowingly or deliberately, Simplicio, the defender of the Aristotelian Geocentric view in <em>Dialogue Concerning the Two Chief World Systems</em>, was often caught in his own errors and sometimes came across as a fool. This fact made <em>Dialogue Concerning the Two Chief World Systems</em> appear as an advocacy book; an attack on Aristotelian geocentrism and defense of the Copernican theory. To add insult to injury<sup style="WHITE-SPACE: nowrap" class="noprint Inline-Template" title="This statement may not be entirely without bias from June 2009"><font size="2">[<em>neutrality disputed</em>]</font></sup>, Galileo put the words of Pope Urban VIII into the mouth of Simplicio. Most historians agree Galileo did not act out of malice and felt blindsided by the reaction to his book.<sup id="cite_ref-90" class="reference"><font size="2"><span>[</span>91<span>]</span></font></sup> However, the Pope did not take the suspected public ridicule lightly, nor the blatant bias. Galileo had alienated one of his biggest and most powerful supporters, the Pope, and was called to Rome to defend his writings.</font></p>
| |
− | <p><font color="#000000">With the loss of many of his defenders in Rome because of <em>Dialogue Concerning the Two Chief World Systems</em>, Galileo was ordered to stand trial on suspicion of heresy in 1633. The sentence of the Inquisition was in three essential parts:</font></p>
| |
− | <ul>
| |
− | <li><font color="#000000">Galileo was found "vehemently suspect of heresy," namely of having held the opinions that the Sun lies motionless at the centre of the universe, that the Earth is not at its centre and moves, and that one may hold and defend an opinion as probable after it has been declared contrary to Holy Scripture. He was required to "abjure, curse and detest" those opinions.<sup id="cite_ref-91" class="reference"><font size="2"><span>[</span>92<span>]</span></font></sup></font> </li>
| |
− | <li><font color="#000000">He was ordered imprisoned; the sentence was later commuted to house arrest.</font> </li>
| |
− | <li><font color="#000000">His offending <em>Dialogue</em> was banned; and in an action not announced at the trial, publication of any of his works was forbidden, including any he might write in the future.<sup id="cite_ref-92" class="reference"><font size="2"><span>[</span>93<span>]</span></font></sup></font> </li>
| |
− | </ul>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 182px" class="thumbinner"><font color="#000000"><font size="2"><img class="thumbimage" alt="" width="180" height="135" src="http://upload.wikimedia.org/wikipedia/en/thumb/b/bd/Tomb_of_Galileo_Galilei.JPG/180px-Tomb_of_Galileo_Galilei.JPG" /></font> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">Tomb of Galileo Galilei, Santa Croce</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">According to popular legend, after recanting his theory that the Earth moved around the Sun, Galileo allegedly muttered the rebellious phrase <em>And yet it moves</em>, but there is no evidence that he actually said this or anything similarly impertinent. The first account of the legend dates to a century after his death.<sup id="cite_ref-93" class="reference"><font size="2"><span>[</span>94<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">After a period with the friendly Ascanio Piccolomini (the Archbishop of Siena), Galileo was allowed to return to his villa at Arcetri near Florence, where he spent the remainder of his life under house arrest, and where he later became blind. It was while Galileo was under house arrest that he dedicated his time to one of his finest works, <em>Two New Sciences</em>. Here he summarized work he had done some forty years earlier, on the two sciences now called kinematics and strength of materials. This book has received high praise from both Sir Isaac Newton and Albert Einstein.<sup style="WHITE-SPACE: nowrap" class="noprint Template-Fact" title="This claim needs references to reliable sources from July 2008"><font size="2">[<em>citation needed</em>]</font></sup> As a result of this work, Galileo is often called, the "father of modern physics."</font></p>
| |
− | <p><font color="#000000">Galileo died on 8 January 1642 at 77 years of age. The Grand Duke of Tuscany, Ferdinando II, wished to bury him in the main body of the Basilica of Santa Croce, next to the tombs of his father and other ancestors, and to erect a marble mausoleum in his honour.<sup id="cite_ref-funeral_94-0" class="reference"><font size="2"><span>[</span>95<span>]</span></font></sup> These plans were scrapped, however, after Pope Urban VIII and his nephew, Cardinal Francesco Barberini, protested.<sup id="cite_ref-funeral_protests_95-0" class="reference"><font size="2"><span>[</span>96<span>]</span></font></sup> He was instead buried in a small room next to the novices' chapel at the end of a corridor from the southern transept of the basilica to the sacristy.<sup id="cite_ref-burial_spot_96-0" class="reference"><font size="2"><span>[</span>97<span>]</span></font></sup> He was reburied in the main body of the basilica in 1737 after a monument had been erected there in his honour.<sup id="cite_ref-reburial_spot_97-0" class="reference"><font size="2"><span>[</span>98<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">The Inquisition's ban on reprinting Galileo's works was lifted in 1718 when permission was granted to publish an edition of his works (excluding the condemned <em>Dialogue</em>) in Florence.<sup id="cite_ref-incomplete_works_98-0" class="reference"><font size="2"><span>[</span>99<span>]</span></font></sup> In 1741 Pope Benedict XIV authorized the publication of an edition of Galileo's complete scientific works<sup id="cite_ref-complete_works_1_99-0" class="reference"><font size="2"><span>[</span>100<span>]</span></font></sup> which included a mildly censored version of the <em>Dialogue</em>.<sup id="cite_ref-complete_works_2_100-0" class="reference"><font size="2"><span>[</span>101<span>]</span></font></sup> In 1758 the general prohibition against works advocating heliocentrism was removed from the Index of prohibited books, although the specific ban on uncensored versions of the <em>Dialogue</em> and Copernicus's <em>De Revolutionibus</em> remained.<sup id="cite_ref-ban_not_lifted_101-0" class="reference"><font size="2"><span>[</span>102<span>]</span></font></sup> All traces of official opposition to heliocentrism by the Church disappeared in 1835 when these works were finally dropped from the Index.<sup id="cite_ref-ban_lifted_102-0" class="reference"><font size="2"><span>[</span>103<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">In 1939 Pope Pius XII, in his first speech to the Pontifical Academy of Sciences, within a few months of his election to the papacy, described Galileo as being among the <em>"most audacious heroes of research ... not afraid of the stumbling blocks and the risks on the way, nor fearful of the funereal monuments"</em><sup id="cite_ref-103" class="reference"><font size="2"><span>[</span>104<span>]</span></font></sup> His close advisor of 40 years, Professor Robert Leiber wrote: "Pius XII was very careful not to close any doors (to science) prematurely. He was energetic on this point and regretted that in the case of Galileo."<sup id="cite_ref-104" class="reference"><font size="2"><span>[</span>105<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">On 15 February 1990, in a speech delivered at the Sapienza University of Rome,<sup id="cite_ref-105" class="reference"><font size="2"><span>[</span>106<span>]</span></font></sup> Cardinal Ratzinger (later to become Pope Benedict XVI) cited some current views on the Galileo affair as forming what he called "a symptomatic case that permits us to see how deep the self-doubt of the modern age, of science and technology goes today."<sup id="cite_ref-self-doubt_106-0" class="reference"><font size="2"><span>[</span>107<span>]</span></font></sup> Some of the views he cited were those of the philosopher Paul Feyerabend, whom he quoted as saying “The Church at the time of Galileo kept much more closely to reason than did Galileo himself, and she took into consideration the ethical and social consequences of Galileo's teaching too. Her verdict against Galileo was rational and just and the revision of this verdict can be justified only on the grounds of what is politically opportune.”<sup id="cite_ref-scupper_107-0" class="reference"><font size="2"><span>[</span>108<span>]</span></font></sup> The Cardinal did not clearly indicate whether he agreed or disagreed with Feyerabend's assertions. He did, however, say "It would be foolish to construct an impulsive apologetic on the basis of such views."<sup id="cite_ref-self-doubt_106-1" class="reference"><font size="2"><span>[</span>107<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">On 31 October 1992, Pope John Paul II expressed regret for how the Galileo affair was handled, and officially conceded that the Earth was not stationary, as the result of a study conducted by the Pontifical Council for Culture.<sup id="cite_ref-108" class="reference"><font size="2"><span>[</span>109<span>]</span></font></sup><sup id="cite_ref-109" class="reference"><font size="2"><span>[</span>110<span>]</span></font></sup> In March 2008 the Vatican proposed to complete its rehabilitation of Galileo by erecting a statue of him inside the Vatican walls.<sup id="cite_ref-110" class="reference"><font size="2"><span>[</span>111<span>]</span></font></sup> In December of the same year, during events to mark the 400th anniversary of Galileo's earliest telescopic observations, Pope Benedict XVI praised his contributions to astronomy.<sup id="cite_ref-111" class="reference"><font size="2"><span>[</span>112<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000" size="2"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">His writings</font></span></h2>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 142px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="140" height="252" src="http://upload.wikimedia.org/wikipedia/commons/thumb/e/ef/Galileo_Galilei01.jpg/140px-Galileo_Galilei01.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">Statue outside the Uffizi, Florence.</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">Galileo's early works describing scientific instruments include the 1586 tract entitled <em>The Little Balance</em> (<em>La Billancetta</em>) describing an accurate balance to weigh objects in air or water<sup id="cite_ref-112" class="reference"><font size="2"><span>[</span>113<span>]</span></font></sup> and the 1606 printed manual <em>Le Operazioni del Compasso Geometrico et Militare</em> on the operation of a geometrical and military compass.<sup id="cite_ref-113" class="reference"><font size="2"><span>[</span>114<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">His early works in dynamics, the science of motion and mechanics were his 1590 Pisan <em>De Motu</em> (On Motion) and his <em>circa</em> 1600 Paduan <em>Le Meccaniche</em> (Mechanics). The former was based on Aristotelian-Archimedean fluid dynamics and held that the speed of gravitational fall in a fluid medium was proportional to the excess of a body's specific weight over that of the medium, whereby in a vacuum bodies would fall with speeds in proportion to their specific weights. It also subscribed to the Hipparchan-Philoponan impetus dynamics in which impetus is self-dissipating and free-fall in a vacuum would have an essential terminal speed according to specific weight after an initial period of acceleration.</font></p>
| |
− | <p><font color="#000000">Galileo's 1610 <em>The Starry Messenger</em> (<em>Sidereus Nuncius</em>) was the first scientific treatise to be published based on observations made through a telescope. It reported his discoveries of:</font></p>
| |
− | <ul>
| |
− | <li><font color="#000000">the Galilean moons;</font> </li>
| |
− | <li><font color="#000000">the roughness of the Moon's surface;</font> </li>
| |
− | <li><font color="#000000">the existence of a large number of stars invisible to the naked eye, particularly those responsible for the appearance of the Milky Way; and</font> </li>
| |
− | <li><font color="#000000">differences between the appearances of the planets and those of the fixed stars—the former appearing as small discs, while the latter appeared as unmagnified points of light.</font> </li>
| |
− | </ul>
| |
− | <p><font color="#000000">Galileo published a description of sunspots in 1613 entitled <em>Letters on Sunspots</em><sup id="cite_ref-114" class="reference"><font size="2"><span>[</span>115<span>]</span></font></sup> suggesting the Sun and heavens are corruptible. The <em>Letters on Sunspots</em> also reported his 1610 telescopic observations of the full set of phases of Venus, and his discovery of the puzzling "appendages" of Saturn and their even more puzzling subsequent disappearance. In 1615 Galileo prepared a manuscript known as the <em>Letter to the Grand Duchess Christina</em> which was not published in printed form until 1636. This letter was a revised version of the <em>Letter to Castelli</em>, which was denounced by the Inquisition as an incursion upon theology by advocating Copernicanism both as physically true and as consistent with Scripture.<sup id="cite_ref-115" class="reference"><font size="2"><span>[</span>116<span>]</span></font></sup> In 1616, after the order by the inquisition for Galileo not to hold or defend the Copernican position, Galileo wrote the <em>Discourse on the tides</em> (<em>Discorso sul flusso e il reflusso del mare</em>) based on the Copernican earth, in the form of a private letter to Cardinal Orsini.<sup id="cite_ref-116" class="reference"><font size="2"><span>[</span>117<span>]</span></font></sup> In 1619, Mario Guiducci, a pupil of Galileo's, published a lecture written largely by Galileo under the title <em>Discourse on the Comets</em> (<em>Discorso Delle Comete</em>), arguing against the Jesuit interpretation of comets.<sup id="cite_ref-117" class="reference"><font size="2"><span>[</span>118<span>]</span></font></sup></font></p>
| |
− | <p><font color="#000000">In 1623, Galileo published <em>The Assayer – Il Saggiatore</em>, which attacked theories based on Aristotle's authority and promoted experimentation and the mathematical formulation of scientific ideas. The book was highly successful and even found support among the higher echelons of the Christian church.<sup id="cite_ref-118" class="reference"><font size="2"><span>[</span>119<span>]</span></font></sup> Following the success of The Assayer, Galileo published the <em>Dialogue Concerning the Two Chief World Systems</em> (Dialogo sopra i due massimi sistemi del mondo) in 1632. Despite taking care to adhere to the Inquisition's 1616 instructions, the claims in the book favouring Copernican theory and a non Geocentric model of the solar system led to Galileo being tried and banned on publication. Despite the publication ban, Galileo published his <em>Discourses and Mathematical Demonstrations Relating to Two New Sciences</em> (<em>Discorsi e Dimostrazioni Matematiche, intorno a due nuove scienze</em>) in 1638 in Holland, outside the jurisdiction of the Inquisition.</font></p>
| |
− | <ul>
| |
− | <li><font color="#000000"><em>The Little Balance</em> (1586)</font> </li>
| |
− | <li><font color="#000000"><em>On Motion</em> (1590) <sup id="cite_ref-119" class="reference"><font size="2"><span>[</span>120<span>]</span></font></sup></font> </li>
| |
− | <li><font color="#000000"><em>Mechanics</em> (c1600)</font> </li>
| |
− | <li><font color="#000000"><em>The Starry Messenger</em> (1610; in Latin, Sidereus Nuncius)</font> </li>
| |
− | <li><font color="#000000"><em>Letters on Sunspots</em> (1613)</font> </li>
| |
− | <li><font color="#000000"><em>Letter to the Grand Duchess Christina</em> (1615; published in 1636)</font> </li>
| |
− | <li><font color="#000000"><em>Discourse on the Tides</em> (1616; in Italian, Discorso del flusso e reflusso del mare)</font> </li>
| |
− | <li><font color="#000000"><em>Discourse on the Comets</em> (1619; in Italian, Discorso Delle Comete)</font> </li>
| |
− | <li><font color="#000000"><em>The Assayer</em> (1623; in Italian, Il Saggiatore)</font> </li>
| |
− | <li><font color="#000000"><em>Dialogue Concerning the Two Chief World Systems</em> (1632; in Italian Dialogo dei due massimi sistemi del mondo)</font> </li>
| |
− | <li><font color="#000000"><em>Discourses and Mathematical Demonstrations Relating to Two New Sciences</em> (1638; in Italian, Discorsi e Dimostrazioni Matematiche, intorno a due nuove scienze)</font> </li>
| |
− | </ul>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Legacy</font></span></h2>
| |
− | <p><font color="#000000">Galileo's astronomical discoveries and investigations into the Copernican theory have led to a lasting legacy which includes the categorisation of the four large moons of Jupiter discovered by Galileo (Io, Europa, Ganymede and Callisto) as the Galilean moons. Other scientific endeavours and principles are named after Galileo including the Galileo spacecraft,<sup id="cite_ref-120" class="reference"><font size="2"><span>[</span>121<span>]</span></font></sup> the first spacecraft to enter orbit around Jupiter, the proposed Galileo global satellite navigation system, the transformation between inertial systems in classical mechanics denoted Galilean transformation and the Gal (unit), sometimes known as the <em>Galileo</em> which is a non-SI unit of acceleration.</font></p>
| |
− | <div class="thumb tright">
| |
− | <div style="WIDTH: 162px" class="thumbinner"><font color="#000000"><img class="thumbimage" alt="" width="160" height="159" src="http://upload.wikimedia.org/wikipedia/en/thumb/f/fe/2009_Austria_25_Euro_Year_of_Astronomy_Front.jpg/160px-2009_Austria_25_Euro_Year_of_Astronomy_Front.jpg" /> </font>
| |
− | <div class="thumbcaption">
| |
− | <div class="magnify"><font color="#000000"><img alt="" width="15" height="11" src="/skins-1.5/common/images/magnify-clip.png" /></font></div>
| |
− | <font color="#000000">International Year of Astronomy commemorative coin</font></div>
| |
− | </div>
| |
− | </div>
| |
− | <p><font color="#000000">Partly because 2009 is the fourth centenary of Galileo's first recorded astronomical observations with the telescope, the United Nations has scheduled it to be the International Year of Astronomy.<sup id="cite_ref-121" class="reference"><font size="2"><span>[</span>122<span>]</span></font></sup> A global scheme laid out by the International Astronomical Union (IAU), it has also been endorsed by UNESCO — the UN body responsible for Educational, Scientific and Cultural matters. The International Year of Astronomy 2009 is intended to be a global celebration of astronomy and its contributions to society and culture, stimulating worldwide interest not only in astronomy but science in general, with a particular slant towards young people.</font></p>
| |
− | <p><font color="#000000">The 20th century German playwright Bertolt Brecht dramatised Galileo's life in his <em>Life of Galileo</em> (1943). A film adaptation with the title <em>Galileo</em> was released in 1975.</font></p>
| |
− | <p><font color="#000000">Galileo Galilei was recently selected as a main motif for a high value collectors' coin: the €25 International Year of Astronomy commemorative coin, minted in 2009. This coin also commemorates the 400th anniversary of the invention of Galileo's telescope. The obverse shows a portion of his portrait and his telescope. The background shows one of his first drawings of the surface of the moon. In the silver ring other telescopes are depicted: the Isaac Newton Telescope, the observatory in Kremsmünster Abbey, a modern telescope, a radio telescope and a space telescope.</font></p>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">Notes</font></span></h2>
| |
− | <div style="-moz-column-count: 2; column-count: 2" class="references-small references-column-count references-column-count-2">
| |
− | <ol class="references">
| |
− | <li id="cite_note-McTutor-0"><font color="#000000">^ <sup><em><strong><font size="2">a</font></strong></em></sup> <sup><em><strong><font size="2">b</font></strong></em></sup> <sup><em><strong><font size="2">c</font></strong></em></sup> <sup><em><strong><font size="2">d</font></strong></em></sup> <sup><em><strong><font size="2">e</font></strong></em></sup> <sup><em><strong><font size="2">f</font></strong></em></sup> <sup><em><strong><font size="2">g</font></strong></em></sup> <cite style="FONT-STYLE: normal" id="CITEREFO.27ConnorRobertson.2C_E._F." class="web">O'Connor, J. J.; Robertson, E. F.. "Galileo Galilei". <em><span>The MacTutor History of Mathematics archive</span></em>. University of St Andrews, Scotland<span class="printonly">. http://www-history.mcs.st-andrews.ac.uk/Biographies/Galileo.html</span><span class="reference-accessdate">. Retrieved 2007-07-24</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Galileo+Galilei&rft.atitle=The+MacTutor+History+of+Mathematics+archive&rft.aulast=O%27Connor&rft.aufirst=J.+J.&rft.au=O%27Connor%2C+J.+J.&rft.au=Robertson%2C+E.+F.&rft.pub=%5B%5BUniversity+of+St+Andrews%5D%5D%2C+%5B%5BScotland%5D%5D&rft_id=http%3A%2F%2Fwww-history.mcs.st-andrews.ac.uk%2FBiographies%2FGalileo.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-birthdate-1"><font color="#000000"><strong>^</strong> Drake (1978, p.1). The date of Galileo's birth is given according to the Julian calendar, which was then in force throughout the whole of Christendom. In 1582 it was replaced in Italy and several other Catholic countries with the Gregorian calendar. Unless otherwise indicated, dates in this article are given according to the Gregorian calendar.</font> </li>
| |
− | <li id="cite_note-2"><font color="#000000"><strong>^</strong> <img alt="" width="15" height="16" src="http://upload.wikimedia.org/wikipedia/commons/thumb/4/4c/Wikisource-logo.svg/15px-Wikisource-logo.svg.png" /> "Galileo Galilei" in the 1913 <em>Catholic Encyclopedia</em>. by John Gerard. Retrieved 11 August 2007</font> </li>
| |
− | <li id="cite_note-3"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFSinger1941">Singer, Charles (1941), <em>A Short History of Science to the Nineteenth Century</em>, Clarendon Press<span class="printonly">, http://www.google.com.au/books?id=mPIgAAAAMAAJ&pgis=1</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=A+Short+History+of+Science+to+the+Nineteenth+Century&rft.aulast=Singer&rft.aufirst=Charles&rft.au=Singer%2C+Charles&rft.date=1941&rft.pub=Clarendon+Press&rft_id=http%3A%2F%2Fwww.google.com.au%2Fbooks%3Fid%3DmPIgAAAAMAAJ%26pgis%3D1&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span> (page 217)</font> </li>
| |
− | <li id="cite_note-Einstein-4"><font color="#000000">^ <sup><em><strong><font size="2">a</font></strong></em></sup> <sup><em><strong><font size="2">b</font></strong></em></sup> <cite style="FONT-STYLE: normal" id="CITEREFWeidhorn2005" class="book">Weidhorn, Manfred (2005). <em><span>The Person of the Millennium: The Unique Impact of Galileo on World History</span></em>. iUniverse. pp. 155. ISBN 0-595-36877-8.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Person+of+the+Millennium%3A+The+Unique+Impact+of+Galileo+on+World+History&rft.aulast=Weidhorn&rft.aufirst=Manfred&rft.au=Weidhorn%2C+Manfred&rft.date=2005&rft.pages=pp.%26nbsp%3B155&rft.pub=iUniverse&rft.isbn=0-595-36877-8&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-finocchiaro2007-5"><font color="#000000"><strong>^</strong> Finocchiaro (2007).</font> </li>
| |
− | <li id="cite_note-6"><font color="#000000"><strong>^</strong> "Galileo and the Birth of Modern Science, by Stephen Hawking, American Heritage's Invention & Technology, Spring 2009, Vol. 24, No. 1, p. 36</font> </li>
| |
− | <li id="cite_note-contrary_to_scripture-7"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.127–131), McMullin (2005a).</font> </li>
| |
− | <li id="cite_note-8"><font color="#000000"><strong>^</strong> Reston (2000, pp. 3–14).</font> </li>
| |
− | <li id="cite_note-9"><font color="#000000"><strong>^</strong> Sharratt (1994, pp. 45–66).</font> </li>
| |
− | <li id="cite_note-10"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFRutkin" class="web">Rutkin, H. Darrel. "Galileo, Astrology, and the Scientific Revolution: Another Look". Program in History & Philosophy of Science & Technology, Stanford University.<span class="printonly">. http://www.stanford.edu/dept/HPST/colloquia0405.html</span><span class="reference-accessdate">. Retrieved 2007-04-15</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Galileo%2C+Astrology%2C+and+the+Scientific+Revolution%3A+Another+Look&rft.atitle=&rft.aulast=Rutkin&rft.aufirst=H.+Darrel&rft.au=Rutkin%2C+H.+Darrel&rft.pub=Program+in+History+%26+Philosophy+of+Science+%26+Technology%2C+Stanford+University.&rft_id=http%3A%2F%2Fwww.stanford.edu%2Fdept%2FHPST%2Fcolloquia0405.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-11"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.17, 213)</font> </li>
| |
− | <li id="cite_note-daughters_unmarriageable-12"><font color="#000000"><strong>^</strong> Sobel (2000, p.5) Chapter 1. Retrieved on 26 August 2007. "But because he never married Virginia's mother, he deemed the girl herself unmarriageable. Soon after her thirteenth birthday, he placed her at the Convent of San Matteo in Arcetri."</font> </li>
| |
− | <li id="cite_note-13"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFPedersen" class="book">Pedersen, O. (24 May–27, 1984). "Galileo's Religion". Proceedings of the Cracow Conference, The Galileo affair: A meeting of faith and science. Cracow: Dordrecht, D. Reidel Publishing Co.. pp. 75-102.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Galileo%27s+Religion&rft.atitle=&rft.aulast=Pedersen&rft.aufirst=O.&rft.au=Pedersen%2C+O.&rft.date=24+May%E2%80%9327%2C+1984&rft.series=Proceedings+of+the+Cracow+Conference%2C+The+Galileo+affair%3A+A+meeting+of+faith+and+science&rft.pages=pp.%26nbsp%3B75-102&rft.place=Cracow&rft.pub=Dordrecht%2C+D.+Reidel+Publishing+Co.&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-14"><font color="#000000"><strong>^</strong> Gebler (1879, pp. 22–35).</font> </li>
| |
− | <li id="cite_note-15"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFAnonymous2007" class="web">Anonymous (2007). "History". Accademia Nazionale dei Lincei<span class="printonly">. http://www.lincei.it/modules.php?name=Content&pa=showpage&pid=21</span><span class="reference-accessdate">. Retrieved 2008-06-10</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=History&rft.atitle=&rft.aulast=Anonymous&rft.au=Anonymous&rft.date=2007&rft.pub=Accademia+Nazionale+dei+Lincei&rft_id=http%3A%2F%2Fwww.lincei.it%2Fmodules.php%3Fname%3DContent%26pa%3Dshowpage%26pid%3D21&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-16"><font color="#000000"><strong>^</strong> There are contradictory documents describing the nature of this admonition and the circumstances of its delivery. Finocchiaro, <em>The Galileo Affair</em>, pp.147–149, 153</font> </li>
| |
− | <li id="cite_note-17"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFCarney2000" class="book">Carney, Jo Eldridge (2000). <em><span>Renaissance and Reformation, 1500-1620: a</span></em>. Greenwood Publishing Group. ISBN 0-313-30574-9.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Renaissance+and+Reformation%2C+1500-1620%3A+a&rft.aulast=Carney&rft.aufirst=Jo+Eldridge&rft.au=Carney%2C+Jo+Eldridge&rft.date=2000&rft.pub=Greenwood+Publishing+Group&rft.isbn=0-313-30574-9&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-18"><font color="#000000"><strong>^</strong> Allan-Olney (1870)</font> </li>
| |
− | <li id="cite_note-19"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.204–05)</font> </li>
| |
− | <li id="cite_note-20"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFCohen1984" class="book">Cohen, H. F. (1984). <em><span>Quantifying Music: The Science of Music at</span></em>. Springer. pp. 78–84. ISBN 90-277-1637-4.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Quantifying+Music%3A+The+Science+of+Music+at&rft.aulast=Cohen&rft.aufirst=H.+F.&rft.au=Cohen%2C+H.+F.&rft.date=1984&rft.pages=pp.%26nbsp%3B78%E2%80%9384&rft.pub=Springer&rft.isbn=90-277-1637-4&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-21"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFField2005" class="book">Field, Judith Veronica (2005). <em><span>Piero Della Francesca: A Mathematician's Art</span></em>. Yale University Press. pp. 317–320. ISBN 0-300-10342-5.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Piero+Della+Francesca%3A+A+Mathematician%27s+Art&rft.aulast=Field&rft.aufirst=Judith+Veronica&rft.au=Field%2C+Judith+Veronica&rft.date=2005&rft.pages=pp.%26nbsp%3B317%E2%80%93320&rft.pub=Yale+University+Press&rft.isbn=0-300-10342-5&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-22"><font color="#000000"><strong>^</strong> In Drake (1957, pp.237−238)</font> </li>
| |
− | <li id="cite_note-23"><font color="#000000"><strong>^</strong> Wallace, (1984).</font> </li>
| |
− | <li id="cite_note-24"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFFeyerabend1993" class="book">Feyerabend, Paul (1993). <em><span>Against Method</span></em> (3rd ed.). London: Verso. p. 129. ISBN 0-86091-646-4.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Against+Method&rft.aulast=Feyerabend&rft.aufirst=Paul&rft.au=Feyerabend%2C+Paul&rft.date=1993&rft.pages=p.%26nbsp%3B129&rft.edition=3rd&rft.place=London&rft.pub=Verso&rft.isbn=0-86091-646-4&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-25"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.202–04), Galilei (1954, pp.250–52), Favaro (1898, 8:274–75) <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span></font> </li>
| |
− | <li id="cite_note-26"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.202–04), Galilei (1954, pp.252), Favaro (1898, 8:275) <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span></font> </li>
| |
− | <li id="cite_note-Hawking_galileo-27"><font color="#000000"><strong>^</strong> Hawking (1988, p.179).</font> </li>
| |
− | <li id="cite_note-father_of_science_Einstein-28"><font color="#000000"><strong>^</strong> Einstein (1954, p.271). "Propositions arrived at by purely logical means are completely empty as regards reality. Because Galileo realised this, and particularly because he drummed it into the scientific world, he is the father of modern physics—indeed, of modern science altogether."</font> </li>
| |
− | <li id="cite_note-29"><font color="#000000"><strong>^</strong> Drake (1990, pp.133–34).</font> </li>
| |
− | <li id="cite_note-invisible-30"><font color="#000000"><strong>^</strong> <em>i.e.</em>, invisible to the naked eye.</font> </li>
| |
− | <li id="cite_note-jupiter.27s_moons-31"><font color="#000000"><strong>^</strong> Drake (1978, p.146).</font> </li>
| |
− | <li id="cite_note-moonconclusion-32"><font color="#000000"><strong>^</strong> In <em>Sidereus Nuncius</em> (Favaro,1892, 3:81<span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Latin)</font></span>) Galileo stated that he had reached this conclusion on 11 January. Drake (1978, p.152), however, after studying unpublished manuscript records of Galileo's observations, concluded that he did not do so until 15 January.</font> </li>
| |
− | <li id="cite_note-medicean_stars-33"><font color="#000000"><strong>^</strong> Sharratt (1994, p.17).</font> </li>
| |
− | <li id="cite_note-34"><font color="#000000"><strong>^</strong> Linton (2004, pp.98,205), Drake (1978, p.157).</font> </li>
| |
− | <li id="cite_note-scepticism-35"><font color="#000000"><strong>^</strong> Drake (1978, p.158–68), Sharratt (1994, p.18–19).</font> </li>
| |
− | <li id="cite_note-36"><font color="#000000"><strong>^</strong> <em>God's Philosophers</em> ju James Hannam Orion 2009 p313</font> </li>
| |
− | <li id="cite_note-periods-37"><font color="#000000"><strong>^</strong> Drake (1978, p.168), Sharratt (1994, p.93).</font> </li>
| |
− | <li id="cite_note-38"><font color="#000000"><strong>^</strong> Thoren (1989), p.8; Hoskin (1999) p.117.</font> </li>
| |
− | <li id="cite_note-39"><font color="#000000"><strong>^</strong> In the Capellan model only Mercury and Venus orbit the Sun, whilst in its extended version such as expounded by Riccioli, Mars also orbits the Sun, but the orbits of Jupiter and Saturn are centred on the Earth</font> </li>
| |
− | <li id="cite_note-40"><font color="#000000"><strong>^</strong> Baalke, Ron. Historical Background of Saturn's Rings. Jet Propulsion Laboratory, California Institute of Technology, NASA. Retrieved on <span class="mw-formatted-date" title="2007-03-11">2007-03-11</span></font> </li>
| |
− | <li id="cite_note-41"><font color="#000000"><strong>^</strong> In Kepler's Thomist 'inertial' variant of Aristotelian dynamics as opposed to Galileo's impetus dynamics variant all bodies universally have an inherent resistance to all motion and tendency to rest, which he dubbed 'inertia'. This notion of inertia was originally introduced by Averroes in the 12th century just for the celestial spheres in order to explain why they do not rotate with infinite speed on Aristotelian dynamics, as they should if they had no resistance to their movers. And in his <em>Astronomia Nova</em> celestial mechanics the inertia of the planets is overcome in their solar orbital motion by their being pushed around by the sunspecks of the rotating sun acting like the spokes of a rotating cartwheel. And more generally it predicted all but only planets with orbiting satellites, such as Jupiter for example, also rotate to push them around, whereas the Moon, for example, does not rotate, thus always presenting the same face to the Earth, because it has no satellites to push around. These seem to have been the first successful novel predictions of Thomist 'inertial' Aristotelian dynamics as well as of post-spherist celestial physics. In his 1630 <em>Epitome</em> (See p514 on p896 of the Encyclopædia Britannica 1952 <em>Great Books of the Western World</em> edition) Kepler keenly stressed he had proved the Sun's axial rotation from planetary motions in his <em>Commentaries on Mars</em> Ch 34 long before it was telescopically established by sunspot motion.</font> </li>
| |
− | <li id="cite_note-42"><font color="#000000"><strong>^</strong> Drake (1978, p.209). Sizzi reported the observations he and his companions had made over the course of a year to Orazio Morandi in a letter dated 10 April 1613 (Favaro,1901, 11:491 <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>). Morandi subsequently forwarded a copy to Galileo.</font> </li>
| |
− | <li id="cite_note-sunspot_argument-43"><font color="#000000"><strong>^</strong> In geostatic systems the apparent annual variation in the motion of sunspots could only be explained as the result of an implausibly complicated precession of the Sun's axis of rotation (Linton, 2004, p.212; Sharratt, 1994, p.166; Drake, 1970, pp.191–196) However, in Drake's judgment of this complex issue in Chapter 9 of his 1970 this is not so, for it does not refute non-geostatic geo-rotating geocentric models. For at most the variable annual inclinations of sunspots’ monthly paths to the ecliptic only proved there must be some terrestrial motion, but not necessarily its annual heliocentric orbital motion as opposed to a geocentric daily rotation, and so it did not prove heliocentrism by refuting geocentrism. Thus it could be explained in the semi-Tychonic geocentric model with a daily rotating Earth such as that of Tycho's follower Longomontanus. Especially see p190 and p196 of Drake's article. Thus on this analysis it only refuted the Ptolemaic geostatic geocentric model whose required daily geocentric orbit of the sun would have predicted the annual variation in this inclination should be observed daily, which it is not.</font> </li>
| |
− | <li id="cite_note-scientific_manifesto-44"><font color="#000000"><strong>^</strong> Drake (1960, pp.vii,xxiii–xxiv), Sharratt (1994, pp.139–140).</font> </li>
| |
− | <li id="cite_note-disputatio-45"><font color="#000000"><strong>^</strong> Grassi (1960a).</font> </li>
| |
− | <li id="cite_note-grassi_great_circle-46"><font color="#000000"><strong>^</strong> Drake (1978, p.268), Grassi (1960a, p.16).</font> </li>
| |
− | <li id="cite_note-discourse_on_comets-47"><font color="#000000"><strong>^</strong> Galilei & Guiducci (1960).</font> </li>
| |
− | <li id="cite_note-authorship_of_discourse-48"><font color="#000000"><strong>^</strong> Drake (1960, p.xvi).</font> </li>
| |
− | <li id="cite_note-criticism_of_previous_theories-49"><font color="#000000"><strong>^</strong> Drake (1957, p.222), Drake (1960, p.xvii).</font> </li>
| |
− | <li id="cite_note-Scheiner_insult-50"><font color="#000000"><strong>^</strong> Sharratt (1994, p.135), Drake (1960, p.xii), Galilei & Guiducci (1960, p.24).</font> </li>
| |
− | <li id="cite_note-uncomplimentary_remark-51"><font color="#000000"><strong>^</strong> Sharratt (1994, p.135).</font> </li>
| |
− | <li id="cite_note-jesuits_offended-52"><font color="#000000"><strong>^</strong> Sharratt (1994, p.135), Drake (1960, p.xvii).</font> </li>
| |
− | <li id="cite_note-astronomical_balance-53"><font color="#000000"><strong>^</strong> Grassi (1960b).</font> </li>
| |
− | <li id="cite_note-54"><font color="#000000"><strong>^</strong> Drake (1978, p.494), Favaro(1896, 6:111). The pseudonym was a slightly imperfect anagram of Oratio Grasio Savonensis, a latinized version of his name and home town.</font> </li>
| |
− | <li id="cite_note-the_assayer-55"><font color="#000000"><strong>^</strong> Galilei (1960).</font> </li>
| |
− | <li id="cite_note-masterpiece_of_polemics-56"><font color="#000000"><strong>^</strong> Sharratt (1994, p.137), Drake (1957, p.227).</font> </li>
| |
− | <li id="cite_note-withering_scorn-57"><font color="#000000"><strong>^</strong> Sharratt (1994, p.138–142).</font> </li>
| |
− | <li id="cite_note-assayer_success-58"><font color="#000000"><strong>^</strong> Drake (1960, p.xix).</font> </li>
| |
− | <li id="cite_note-jesuit_alienation-59"><font color="#000000"><strong>^</strong> Drake (1960, p.vii).</font> </li>
| |
− | <li id="cite_note-jesuits_responsible-60"><font color="#000000"><strong>^</strong> Sharratt (1994, p.175).</font> </li>
| |
− | <li id="cite_note-evidence_of_jesuits-61"><font color="#000000"><strong>^</strong> Sharratt (1994, pp.175–78), Blackwell (2006, p.30).</font> </li>
| |
− | <li id="cite_note-62"><font color="#000000"><strong>^</strong> Finocchiaro (1989), pp. 67–9.</font> </li>
| |
− | <li id="cite_note-63"><font color="#000000"><strong>^</strong> Finocchiaro (1989), p. 354, n. 52</font> </li>
| |
− | <li id="cite_note-64"><font color="#000000"><strong>^</strong> Finocchiaro (1989), pp.119–133</font> </li>
| |
− | <li id="cite_note-65"><font color="#000000"><strong>^</strong> Finocchiaro (1989), pp.127–131 and Drake (1953), pp. 432–6</font> </li>
| |
− | <li id="cite_note-66"><font color="#000000"><strong>^</strong> Einstein (1952) p. xvii</font> </li>
| |
− | <li id="cite_note-67"><font color="#000000"><strong>^</strong> Finocchiaro (1989), p. 128</font> </li>
| |
− | <li id="cite_note-68"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFKusukawa" class="web">Kusukawa, Sachiko. "Starry Messenger. The Telescope, Department of History and Philosophy of Science of the University of Cambridge. Retrieved on <span class="mw-formatted-date" title="2007-03-10">2007-03-10</span>]"<span class="printonly">. http://www.hps.cam.ac.uk/starry/galtele.html</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Starry+Messenger.+The+Telescope%5D%2C+Department+of+History+and+Philosophy+of+Science+of+the+University+of+Cambridge.+Retrieved+on+%5B%5B2007-03-10%5D%5D&rft.atitle=&rft.aulast=Kusukawa&rft.aufirst=Sachiko&rft.au=Kusukawa%2C+Sachiko&rft_id=http%3A%2F%2Fwww.hps.cam.ac.uk%2Fstarry%2Fgaltele.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-69"><font color="#000000"><strong>^</strong> Sobel (2000, p.43), Drake (1978, p.196). In the <em>Starry Messenger</em>, written in Latin, Galileo had used the term "perspicillum."</font> </li>
| |
− | <li id="cite_note-70"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="web">"omni-optical.com "<em>A Very Short History of the Telescope</em>""<span class="printonly">. http://www.omni-optical.com/telescope/ut104.htm</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=omni-optical.com+%22%27%27A+Very+Short+History+of+the+Telescope%27%27%22&rft.atitle=&rft_id=http%3A%2F%2Fwww.omni-optical.com%2Ftelescope%2Fut104.htm&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-telescope_microscope-71"><font color="#000000"><strong>^</strong> Drake (1978, p.163–164), Favaro(1892, 3:163–164)<span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Latin)</font></span></font> </li>
| |
− | <li id="cite_note-microscope_perfection-72"><font color="#000000"><strong>^</strong> Probably in 1623, according to Drake (1978, p.286).</font> </li>
| |
− | <li id="cite_note-Zollern_microscope-73"><font color="#000000"><strong>^</strong> Drake (1978, p.289), Favaro(1903, 13:177) <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>.</font> </li>
| |
− | <li id="cite_note-Cesi_microscope-74"><font color="#000000"><strong>^</strong> Drake (1978, p.286), Favaro(1903, 13:208)<span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>. The actual inventors of the telescope and microscope remain debatable. A general view on this can be found in the article Hans Lippershey (last updated <span class="mw-formatted-date" title="2003-08-01">2003-08-01</span>), © 1995–2007 by Davidson, Michael W. and the Florida State University. Retrieved <span class="mw-formatted-date" title="2007-08-28">2007-08-28</span></font> </li>
| |
− | <li id="cite_note-75"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="web">"brunelleschi.imss.fi.it "Il microscopio di Galileo"" (PDF)<span class="printonly">. http://brunelleschi.imss.fi.it/esplora/microscopio/dswmedia/risorse/testi_completi.pdf</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=brunelleschi.imss.fi.it+%22Il+microscopio+di+Galileo%22&rft.atitle=&rft_id=http%3A%2F%2Fbrunelleschi.imss.fi.it%2Fesplora%2Fmicroscopio%2Fdswmedia%2Frisorse%2Ftesti_completi.pdf&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-76"><font color="#000000"><strong>^</strong> Van Helden, Al. Galileo Timeline (last updated 1995), The Galileo Project. Retrieved <span class="mw-formatted-date" title="2007-08-28">2007-08-28</span>. See also Timeline of microscope technology.</font> </li>
| |
− | <li id="cite_note-microscope_use-77"><font color="#000000"><strong>^</strong> Drake (1978, p.286).</font> </li>
| |
− | <li id="cite_note-78"><font color="#000000"><strong>^</strong> Drake (1978, pp.19,20). At the time when Viviani asserts that the experiment took place, Galileo had not yet formulated the final version of his law of free fall. He had, however, formulated an earlier version which predicted that bodies <em>of the same material</em> falling through the same medium would fall at the same speed (Drake, 1978, p.20).</font> </li>
| |
− | <li id="cite_note-79"><font color="#000000"><strong>^</strong> Drake (1978, p.9); Sharratt (1994, p.31).</font> </li>
| |
− | <li id="cite_note-80"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFGroleau" class="web">Groleau, Rick. "Galileo's Battle for the Heavens. July 2002"<span class="printonly">. http://www.pbs.org/wgbh/nova/galileo/experiments.html</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Galileo%27s+Battle+for+the+Heavens.+July+2002&rft.atitle=&rft.aulast=Groleau&rft.aufirst=Rick&rft.au=Groleau%2C+Rick&rft_id=http%3A%2F%2Fwww.pbs.org%2Fwgbh%2Fnova%2Fgalileo%2Fexperiments.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span> <cite style="FONT-STYLE: normal" id="CITEREFBall" class="web">Ball, Phil. "Science history: setting the record straight. 30 June 2005"<span class="printonly">. http://www.hindu.com/seta/2005/06/30/stories/2005063000351500.htm</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Science+history%3A+setting+the+record+straight.+30+June+2005&rft.atitle=&rft.aulast=Ball&rft.aufirst=Phil&rft.au=Ball%2C+Phil&rft_id=http%3A%2F%2Fwww.hindu.com%2Fseta%2F2005%2F06%2F30%2Fstories%2F2005063000351500.htm&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span> An exception is Drake (1978, pp.19–21, 414–416), who argues that the experiment did take place, more or less as Viviani described it.</font> </li>
| |
− | <li id="cite_note-81"><font color="#000000"><strong>^</strong> Lucretius, <em>De rerum natura</em> II, 225–229; Relevant passage appears in: Lane Cooper, <em>Aristotle, Galileo, and the Tower of Pisa</em> (Ithaca, N.Y.: Cornell University Press, 1935), page 49.</font> </li>
| |
− | <li id="cite_note-82"><font color="#000000"><strong>^</strong> Simon Stevin, <em>De Beghinselen des Waterwichts, Anvang der Waterwichtdaet, en de Anhang komen na de Beghinselen der Weeghconst en de Weeghdaet</em> [The Elements of Hydrostatics, Preamble to the Practice of Hydrostatics, and Appendix to The Elements of the Statics and The Practice of Weighing] (Leiden, Netherlands: Christoffel Plantijn, 1586) reports an experiment by Stevin and Jan Cornets de Groot in which they dropped lead balls from a church tower in Delft; relevant passage is translated here: E. J. Dijksterhuis, ed., <em>The Principal Works of Simon Stevin</em> (Amsterdam, Netherlands: C. V. Swets & Zeitlinger, 1955) vol. 1, pages 509 and 511. Available on-line at: http://www.library.tudelft.nl/cgi-bin/digitresor/display.cgi?bookname=Mechanics%20I&page=509</font> </li>
| |
− | <li id="cite_note-83"><font color="#000000"><strong>^</strong> Sharratt (1994, p.203), Galilei (1954, pp.251–54).</font> </li>
| |
− | <li id="cite_note-84"><font color="#000000"><strong>^</strong> Sharratt (1994, p.198), Galilei (1954, p.174).</font> </li>
| |
− | <li id="cite_note-85"><font color="#000000"><strong>^</strong> Clagett (1968, p.561).</font> </li>
| |
− | <li id="cite_note-86"><font color="#000000"><strong>^</strong> Sharratt (1994, p.198), Wallace (2004, pp.II 384, II 400, III 272) Soto, however, did not anticipate many of the qualifications and refinements contained in Galileo's theory of falling bodies. He did not, for instance, recognise, as Galileo did, that a body would only fall with a strictly uniform acceleration in a vacuum, and that it would otherwise eventually reach a uniform terminal velocity.</font> </li>
| |
− | <li id="cite_note-87"><font color="#000000"><strong>^</strong> Galileo Galilei, <em>Two New Sciences,</em> (Madison: Univ. of Wisconsin Pr., 1974) p. 50.</font> </li>
| |
− | <li id="cite_note-88"><font color="#000000"><strong>^</strong> I. Bernard Cohen, "Roemer and the First Determination of the Velocity of Light (1676)," <em>Isis</em>, 31 (1940): 327–379, see pp. 332–333</font> </li>
| |
− | <li id="cite_note-Bellarmine_quote-89"><font color="#000000"><strong>^</strong> Brodrick (1965, c1964, p.95) quoting Cardinal Bellarmine's letter to Foscarini, dated 12 April 1615. Translated from Favaro(1902, 12:171–172) <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>.</font> </li>
| |
− | <li id="cite_note-90"><font color="#000000"><strong>^</strong> See Langford (1966, pp.133–134), and Seeger (1966, p.30), for example. Drake (1978, p.355) asserts that Simplicio's character is modelled on the Aristotelian philosophers, Lodovico delle Colombe and Cesare Cremonini, rather than Urban. He also considers that the demand for Galileo to include the Pope's argument in the <em>Dialogue</em> left him with no option but to put it in the mouth of Simplicio (Drake, 1953, p.491). Even Arthur Koestler, who is generally quite harsh on Galileo in <em>The Sleepwalkers</em> (1959), after noting that Urban suspected Galileo of having intended Simplicio to be a caricature of him, says "this of course is untrue" (1959, p.483)</font> </li>
| |
− | <li id="cite_note-91"><font color="#000000"><strong>^</strong> Fantoli (2005, p.139), Finocchiaro (1989, p.288–293). Finocchiaro's translation of the Inquisition's judgement against Galileo is available on-line. "Vehemently suspect of heresy" was a technical term of canon law and did not necessarily imply that the Inquisition considered the opinions giving rise to the verdict to be heretical. The same verdict would have been possible even if the opinions had been subject only to the less serious censure of "erroneous in faith" (Fantoli, 2005, p.140; Heilbron, 2005, pp.282-284).</font> </li>
| |
− | <li id="cite_note-92"><font color="#000000"><strong>^</strong> <span id="_note-publication-ban"></span>Drake (1978, p.367), Sharratt (1994, p.184), Favaro(1905, 16:209, 230)<span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>. See Galileo affair for further details.</font> </li>
| |
− | <li id="cite_note-93"><font color="#000000"><strong>^</strong> Drake (1978, p.356). The phrase "Eppur si muove" does appear, however, in a painting of the 1640s by the Spanish painter Bartolomé Esteban Murillo or an artist of his school. The painting depicts an imprisoned Galileo apparently pointing to a copy of the phrase written on the wall of his dungeon (Drake, 1978, p.357).</font> </li>
| |
− | <li id="cite_note-funeral-94"><font color="#000000"><strong>^</strong> Shea & Artigas (2003, p.199); Sobel (2000, p.378).</font> </li>
| |
− | <li id="cite_note-funeral_protests-95"><font color="#000000"><strong>^</strong> Shea & Artigas (2003, p.199); Sobel (2000, p.378); Sharratt (1994, p.207); Favaro(1906,18:378–80) <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>.</font> </li>
| |
− | <li id="cite_note-burial_spot-96"><font color="#000000"><strong>^</strong> Shea & Artigas (2003, p.199); Sobel (2000, p.380).</font> </li>
| |
− | <li id="cite_note-reburial_spot-97"><font color="#000000"><strong>^</strong> Shea & Artigas (2003, p.200); Sobel (2000, p.380–384).</font> </li>
| |
− | <li id="cite_note-incomplete_works-98"><font color="#000000"><strong>^</strong> Heilbron (2005, p.299).</font> </li>
| |
− | <li id="cite_note-complete_works_1-99"><font color="#000000"><strong>^</strong> Two of his non-scientific works, the letters to Castelli and the Grand Duchess Christina, were explicitly not allowed to be included (Coyne 2005, p.347).</font> </li>
| |
− | <li id="cite_note-complete_works_2-100"><font color="#000000"><strong>^</strong> Heilbron (2005, p.303–04); Coyne (2005, p.347). The uncensored version of the <em>Dialogue</em> remained on the Index of prohibited books, however (Heilbron 2005, p.279).</font> </li>
| |
− | <li id="cite_note-ban_not_lifted-101"><font color="#000000"><strong>^</strong> Heilbron (2005, p.307); Coyne (2005, p.347) The practical effect of the ban in its later years seems to have been that clergy could publish discussions of heliocentric physics with a formal disclaimer assuring its hypothetical character and their obedience to the church decrees against motion of the earth: see for example the commented edition (1742) of Newton's 'Principia' by Fathers Le Seur and Jacquier, which contains such a disclaimer ('Declaratio') before the third book (Propositions 25 onwards) dealing with the lunar theory.</font> </li>
| |
− | <li id="cite_note-ban_lifted-102"><font color="#000000"><strong>^</strong> McMullin (2005, p.6); Coyne (2005, p.346). In fact, the Church's opposition had effectively ended in 1820 when a Catholic canon, Giuseppe Settele, was given permission to publish a work which treated heliocentism as a physical fact rather than a mathematical fiction. The 1835 edition of the Index was the first to be issued after that year.</font> </li>
| |
− | <li id="cite_note-103"><font color="#000000"><strong>^</strong> Discourse of His Holiness Pope Pius XII given on 3 December 1939 at the Solemn Audience granted to the Plenary Session of the Academy, Discourses of the Popes from Pius XI to John Paul II to the Pontifical Academy of the Sciences 1939-1986, Vatican City, p.34</font> </li>
| |
− | <li id="cite_note-104"><font color="#000000"><strong>^</strong> Robert Leiber, Pius XII Stimmen der Zeit, November 1958 in Pius XII. Sagt, Frankfurt 1959, p.411</font> </li>
| |
− | <li id="cite_note-105"><font color="#000000"><strong>^</strong> An earlier version had been delivered on 16 December 1989, in Rieti, and a later version in Madrid on 24 February 1990 (Ratzinger, 1994, p.81). According to Feyerabend himself, Ratzinger had also mentioned him "in support of" his own views in a speech in Parma around the same time (Feyerabend, 1995, p.178).</font> </li>
| |
− | <li id="cite_note-self-doubt-106"><font color="#000000">^ <sup><em><strong><font size="2">a</font></strong></em></sup> <sup><em><strong><font size="2">b</font></strong></em></sup> Ratzinger (1994, p.98).</font> </li>
| |
− | <li id="cite_note-scupper-107"><font color="#000000"><strong>^</strong> Ratzinger (1994, p.98)</font> </li>
| |
− | <li id="cite_note-108"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="news">"Vatican admits Galileo was right". New Scientist. 1992-11-07<span class="printonly">. http://www.newscientist.com/article/mg13618460.600-vatican-admits-galileo-was-right-.html</span><span class="reference-accessdate">. Retrieved 2007-08-09</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Vatican+admits+Galileo+was+right&rft.atitle=&rft.date=1992-11-07&rft.pub=New+Scientist&rft_id=http%3A%2F%2Fwww.newscientist.com%2Farticle%2Fmg13618460.600-vatican-admits-galileo-was-right-.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span>.</font> </li>
| |
− | <li id="cite_note-109"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="news">"Papal visit scuppered by scholars". BBC News. 2008-01-15<span class="printonly">. http://news.bbc.co.uk/1/hi/world/europe/7188860.stm</span><span class="reference-accessdate">. Retrieved 2008-01-16</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Papal+visit+scuppered+by+scholars&rft.atitle=&rft.date=2008-01-15&rft.pub=BBC+News&rft_id=http%3A%2F%2Fnews.bbc.co.uk%2F1%2Fhi%2Fworld%2Feurope%2F7188860.stm&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-110"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="news">"Vatican recants with a statue of Galileo". TimesOnline News. 2008-03-04<span class="printonly">. http://www.timesonline.co.uk/tol/comment/faith/article3478943.ece</span><span class="reference-accessdate">. Retrieved 2009-03-02</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Vatican+recants+with+a+statue+of+Galileo&rft.atitle=&rft.date=2008-03-04&rft.pub=TimesOnline+News&rft_id=http%3A%2F%2Fwww.timesonline.co.uk%2Ftol%2Fcomment%2Ffaith%2Farticle3478943.ece&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-111"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" class="news">"Pope praises Galileo's astronomy". BBC News. 2008-12-21<span class="printonly">. http://news.bbc.co.uk/2/hi/europe/7794668.stm</span><span class="reference-accessdate">. Retrieved 2008-12-22</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Pope+praises+Galileo%27s+astronomy&rft.atitle=&rft.date=2008-12-21&rft.pub=BBC+News&rft_id=http%3A%2F%2Fnews.bbc.co.uk%2F2%2Fhi%2Feurope%2F7794668.stm&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-112"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Hydrostatic balance</em>, The Galileo Project<span class="printonly">, http://galileo.rice.edu/sci/instruments/balance.html</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Hydrostatic+balance&rft.pub=The+Galileo+Project&rft_id=http%3A%2F%2Fgalileo.rice.edu%2Fsci%2Finstruments%2Fbalance.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-113"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>The Works of Galileo</em>, The University of Oklahoma, College of Arts and Sciences<span class="printonly">, http://hsci.ou.edu/exhibits/exhibit.php?exbgrp=1&exbid=10&exbpg=1</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Works+of+Galileo&rft.pub=The+University+of+Oklahoma%2C+College+of+Arts+and+Sciences&rft_id=http%3A%2F%2Fhsci.ou.edu%2Fexhibits%2Fexhibit.php%3Fexbgrp%3D1%26exbid%3D10%26exbpg%3D1&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-114"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Sunspots and Floating Bodies</em>, The University of Oklahoma, College of Arts and Sciences<span class="printonly">, http://hsci.ou.edu/exhibits/exhibit.php?exbgrp=1&exbid=13&exbpg=2</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Sunspots+and+Floating+Bodies&rft.pub=The+University+of+Oklahoma%2C+College+of+Arts+and+Sciences&rft_id=http%3A%2F%2Fhsci.ou.edu%2Fexhibits%2Fexhibit.php%3Fexbgrp%3D1%26exbid%3D13%26exbpg%3D2&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-115"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Galileo, Letter to the Grand Duchess Christina</em>, The University of Oklahoma, College of Arts and Sciences<span class="printonly">, http://hsci.ou.edu/exhibits/exhibit.php?exbgrp=1&exbid=14&exbpg=3</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%2C+Letter+to+the+Grand+Duchess+Christina&rft.pub=The+University+of+Oklahoma%2C+College+of+Arts+and+Sciences&rft_id=http%3A%2F%2Fhsci.ou.edu%2Fexhibits%2Fexhibit.php%3Fexbgrp%3D1%26exbid%3D14%26exbpg%3D3&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-116"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Galileo's Theory of the Tides</em>, The Galileo Project<span class="printonly">, http://galileo.rice.edu/sci/observations/tides.html</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%27s+Theory+of+the+Tides&rft.pub=The+Galileo+Project&rft_id=http%3A%2F%2Fgalileo.rice.edu%2Fsci%2Fobservations%2Ftides.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-117"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Galileo Timeline</em>, The Galileo Project<span class="printonly">, http://galileo.rice.edu/chron/galileo.html</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+Timeline&rft.pub=The+Galileo+Project&rft_id=http%3A%2F%2Fgalileo.rice.edu%2Fchron%2Fgalileo.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-118"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal"><em>Galileo Galilei</em>, Tel-Aviv University, Science and Technology Education Center<span class="printonly">, http://muse.tau.ac.il/museum/galileo/galileo.html</span><span class="reference-accessdate">, retrieved 2008-07-17</span></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+Galilei&rft.pub=Tel-Aviv+University%2C+Science+and+Technology+Education+Center&rft_id=http%3A%2F%2Fmuse.tau.ac.il%2Fmuseum%2Fgalileo%2Fgalileo.html&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-119"><font color="#000000"><strong>^</strong> [1]</font> </li>
| |
− | <li id="cite_note-120"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFFischer2001" class="book">Fischer, Daniel (2001). <em><span>Mission Jupiter: The Spectacular Journey of the</span></em> <span>Galileo <em>Spacecraft</em></span>. Springer. pp. v. ISBN 0-387-98764-9.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Mission+Jupiter%3A+The+Spectacular+Journey+of+the+%27%27Galileo%27%27+Spacecraft&rft.aulast=Fischer&rft.aufirst=Daniel&rft.au=Fischer%2C+Daniel&rft.date=2001&rft.pages=pp.%26nbsp%3Bv&rft.pub=Springer&rft.isbn=0-387-98764-9&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li id="cite_note-121"><font color="#000000"><strong>^</strong> <cite style="FONT-STYLE: normal" id="CITEREFUnited_Nations_Educational.2C_Scientific_and_Cultural_Organization2005" class="web">United Nations Educational, Scientific and Cultural Organization (11 August 2005). "Proclamation of 2009 as International year of Astronomy" (PDF). UNESCO<span class="printonly">. http://unesdoc.unesco.org/images/0014/001403/140317e.pdf</span><span class="reference-accessdate">. Retrieved 2008-06-10</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Proclamation+of+2009+as+International+year+of+Astronomy&rft.atitle=&rft.aulast=United+Nations+Educational%2C+Scientific+and+Cultural+Organization&rft.au=United+Nations+Educational%2C+Scientific+and+Cultural+Organization&rft.date=11+August+2005&rft.pub=UNESCO&rft_id=http%3A%2F%2Funesdoc.unesco.org%2Fimages%2F0014%2F001403%2F140317e.pdf&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | </ol>
| |
− | </div>
| |
− | <p><font color="#000000"></font></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">See also</font></span></h2>
| |
− | <ul>
| |
− | <li><font color="#000000">Villa Il Gioiello (Galileo's main home in Florence)</font> </li>
| |
− | </ul>
| |
− | <p><a id="References" name="References"><font color="#000000"></font></a></p>
| |
− | <h2><span class="mw-headline"><font color="#000000">References</font></span></h2>
| |
− | <div style="MARGIN-LEFT: 1.5em; FONT-SIZE: 90%; -moz-column-count: 2; column-count: 2; -webkit-column-count: 2">
| |
− | <ul>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="CITEREFAllan-Olney1870" class="book">Allan-Olney, Mary (1870). <em><a class="external text" title="http://books.google.com/books?id=zWcSAAAAIAAJ" rel="nofollow" href="http://books.google.com/books?id=zWcSAAAAIAAJ">The Private Life of Galileo: Compiled primarily from his correspondence and that of his eldest daughter, Sister Maria Celeste</a></em>. Boston: Nichols and Noyes<span class="printonly">. <a class="external free" title="http://books.google.com/books?id=zWcSAAAAIAAJ" rel="nofollow" href="http://books.google.com/books?id=zWcSAAAAIAAJ">http://books.google.com/books?id=zWcSAAAAIAAJ</a></span><span class="reference-accessdate">. Retrieved 2008-06-09</span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Private+Life+of+Galileo%3A+Compiled+primarily+from+his+correspondence+and+that+of+his+eldest+daughter%2C+Sister+Maria+Celeste&rft.aulast=Allan-Olney&rft.aufirst=Mary&rft.au=Allan-Olney%2C+Mary&rft.date=1870&rft.place=Boston&rft.pub=Nichols+and+Noyes&rft_id=http%3A%2F%2Fbooks.google.com%2Fbooks%3Fid%3DzWcSAAAAIAAJ&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Biagioli-1993" class="book">Biagioli, Mario (1993). <em><span>Galileo, Courtier: The Practice of Science in the Culture of Absolutism</span></em>. Chicago, IL: University of Chicago Press.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%2C+Courtier%3A+The+Practice+of+Science+in+the+Culture+of+Absolutism&rft.aulast=Biagioli&rft.aufirst=Mario&rft.au=Biagioli%2C+Mario&rft.date=1993&rft.place=Chicago%2C+IL&rft.pub=University+of+Chicago+Press&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Blackwell-2006" class="book"><font color="#000000">Blackwell, Richard J. (2006). <em><span>Behind the Scenes at Galileo's Trial</span></em>. Notre Dame, IN: University of Notre Dame Press. </font><a class="internal" href="/wiki/Special:BookSources/0268022011"><font color="#000000">ISBN 0-268-02201-1</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Behind+the+Scenes+at+Galileo%27s+Trial&rft.aulast=Blackwell%2C+Richard+J.&rft.au=Blackwell%2C+Richard+J.&rft.date=2006&rft.place=Notre+Dame%2C+IN&rft.pub=University+of+Notre+Dame+Press&rft.isbn=0-268-02201-1&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Brodrick-1965" class="book">Brodrick, James, S. J. (1965) [c1964]. <em><span>Galileo: the man, his work, his misfortunes</span></em>. London: G. Chapman.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%3A+the+man%2C+his+work%2C+his+misfortunes&rft.aulast=Brodrick%2C+James%2C+S.+J.&rft.au=Brodrick%2C+James%2C+S.+J.&rft.date=1965&rft.place=London&rft.pub=G.+Chapman&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Clagett-1968" class="book"><font color="#000000">Clagett, Marshall (editor & translator) (1968). <em><span>Nicole Oresme and the Medieval Geometry of Qualities and Motions; a treatise on the uniformity and difformity of intensities known as Tractatus de configurationibus qualitatum et motuum</span></em>. Madison, WI: University of Wisconsin Press. </font><a class="internal" href="/wiki/Special:BookSources/0299048802"><font color="#000000">ISBN 0-299-04880-2</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Nicole+Oresme+and+the+Medieval+Geometry+of+Qualities+and+Motions%3B+a+treatise+on+the+uniformity+and+difformity+of+intensities+known+as+Tractatus+de+configurationibus+qualitatum+et+motuum&rft.aulast=Clagett&rft.aufirst=Marshall+%28editor+%26+translator%29&rft.au=Clagett%2C+Marshall+%28editor+%26+translator%29&rft.date=1968&rft.place=Madison%2C+WI&rft.pub=University+of+Wisconsin+Press&rft.isbn=0-299-04880-2&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Clavelin, Maurice <em>The Natural Philosophy of Galileo</em> MIT Press 1974</font> </li>
| |
− | <li><font color="#000000">Coffa,J <em>Galileo's Concept of Inertia</em> Physis 1968</font> </li>
| |
− | <li><font color="#000000">Consolmagno, Guy; Schaefer, Marta (1994) <em>Worlds Apart, A Textbook in Planetary Science</em>. Englewood, New Jersey: Prentice-Hall, Inc. </font><a class="internal" href="/wiki/Special:BookSources/0139641319"><font color="#000000">ISBN 0-13-964131-9</font></a> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Cooper-1935" class="book"><font color="#000000">Cooper, Lane (1935). <em><span>Aristotle, Galileo, and the Tower of Pisa</span></em>. Ithaca, NY: Cornell University Press. </font><a class="internal" href="/wiki/Special:BookSources/1406752630"><font color="#000000">ISBN 1-4067-5263-0</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Aristotle%2C+Galileo%2C+and+the+Tower+of+Pisa&rft.aulast=Cooper&rft.aufirst=Lane&rft.au=Cooper%2C+Lane&rft.date=1935&rft.place=Ithaca%2C+NY&rft.pub=Cornell+University+Press&rft.isbn=1-4067-5263-0&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Coyne-2005" class="book"><font color="#000000">Coyne, George V., S.J. (2005). <em><span>The Church's Most Recent Attempt to Dispel the Galileo Myth</span></em>. In </font><a href="#Reference-McMullin-2005"><font color="#000000">McMullin (2005, pp.340–359)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Church%27s+Most+Recent+Attempt+to+Dispel+the+Galileo+Myth&rft.aulast=Coyne%2C+George+V.%2C+S.J.&rft.au=Coyne%2C+George+V.%2C+S.J.&rft.date=2005&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Drabkin, Israel & Drake, Stillman (Eds & translators) <em>On Motion and On Mechanics</em> University of Wisconsin Press 1960 </font><a class="internal" href="/wiki/Special:BookSources/0299020304"><font color="#000000">ISBN 0-299-02030-4</font></a> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Drake-1953" class="book">Drake, Stillman (translator) (1953). <em><span>Dialogue Concerning the Two Chief World Systems</span></em>. Berkeley, CA: University of California Press.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Dialogue+Concerning+the+Two+Chief+World+Systems&rft.aulast=Drake%2C+Stillman+%28translator%29&rft.au=Drake%2C+Stillman+%28translator%29&rft.date=1953&rft.place=Berkeley%2C+CA&rft.pub=University+of+California+Press&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><cite id="Reference-Drake-1957"><font color="#000000">Drake, Stillman (1957). <em>Discoveries and Opinions of Galileo</em>. New York: Doubleday & Company. </font><a class="internal" href="/wiki/Special:BookSources/0385092393"><font color="#000000">ISBN 0-385-09239-3</font></a></cite> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Drake-1960" class="book"><font color="#000000">Drake, Stillman (1960). <em><span>Introduction to the Controversy on the Comets of 1618</span></em>. In </font><a href="#Reference-Drake.26O.27Malley-1960"><font color="#000000">Drake & O'Malley (1960, pp.vii–xxv)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Introduction+to+the+Controversy+on+the+Comets+of+1618&rft.aulast=Drake%2C+Stillman&rft.au=Drake%2C+Stillman&rft.date=1960&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Drake-1970" class="book"><font color="#000000">Drake, Stillman (1970). <em><span>Galileo Studies</span></em>. Ann Arbor: The University of Michigan Press. </font><a class="internal" href="/wiki/Special:BookSources/0472082833"><font color="#000000">ISBN 0-472-08283-3</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+Studies&rft.aulast=Drake%2C+Stillman&rft.au=Drake%2C+Stillman&rft.date=1970&rft.place=Ann+Arbor&rft.pub=The+University+of+Michigan+Press&rft.isbn=0-472-08283-3&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Drake, Stillman (1973). "Galileo's Discovery of the Law of Free Fall." <em>Scientific American</em> v. 228, #5, pp. 84–92.</font> </li>
| |
− | <li><cite id="Reference-Drake-1978"><font color="#000000">Drake, Stillman (1978). <em>Galileo At Work</em>. Chicago: University of Chicago Press. </font><a class="internal" href="/wiki/Special:BookSources/0226162265"><font color="#000000">ISBN 0-226-16226-5</font></a></cite> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Drake-1990" class="book"><font color="#000000">Drake, Stillman (1990). <em><span>Galileo: Pioneer Scientist</span></em>. Toronto: The University of Toronto Press. </font><a class="internal" href="/wiki/Special:BookSources/0802027253"><font color="#000000">ISBN 0-8020-2725-3</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%3A+Pioneer+Scientist&rft.aulast=Drake&rft.aufirst=Stillman&rft.au=Drake%2C+Stillman&rft.date=1990&rft.place=Toronto&rft.pub=The+University+of+Toronto+Press&rft.isbn=0-8020-2725-3&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Drake.26O.27Malley-1960" class="book">Drake, Stillman, and O'Malley, C.D. (translators) (1960). <em><span>The Controversy on the Comets of 1618</span></em>. Philadelphia, PA: University of Philadelphia Press.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Controversy+on+the+Comets+of+1618&rft.aulast=Drake%2C+Stillman%2C+and+O%27Malley%2C+C.D.+%28translators%29&rft.au=Drake%2C+Stillman%2C+and+O%27Malley%2C+C.D.+%28translators%29&rft.date=1960&rft.place=Philadelphia%2C+PA&rft.pub=University+of+Philadelphia+Press&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><font color="#000000">Dugas,René <em>A History of Mechanics</em> 1955, Dover Publications 1988</font> </li>
| |
− | <li><font color="#000000">Duhem, Pierre <em>Etudes sur Leonard de Vinci</em> 1906-13</font> </li>
| |
− | <li><font color="#000000">Duhem, Pierre <em>Le Systeme du Monde</em> 1913 -</font> </li>
| |
− | <li><font color="#000000">Duhem, Pierre <em>History of Physics</em> Catholic Encyclopedia</font> </li>
| |
− | <li><font color="#000000">Einstein, Albert (1952). Foreword to (Drake, 1953)</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Einstein-1954" class="book"><a title="Albert Einstein" href="/wiki/Albert_Einstein"><font color="#000000">Einstein, Albert</font></a><font color="#000000"> (1954). <em><span>Ideas and Opinions</span></em>. translated by Sonja Bargmann. London: Crown Publishers. </font><a class="internal" href="/wiki/Special:BookSources/0285647245"><font color="#000000">ISBN 0-285-64724-5</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Ideas+and+Opinions&rft.aulast=Einstein%2C+Albert&rft.au=Einstein%2C+Albert&rft.date=1954&rft.place=London&rft.pub=Crown+Publishers&rft.isbn=0-285-64724-5&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Fantoli, Annibale (2003). <em>Galileo — For Copernicanism and the Church</em>, third English edition. Vatican Observatory Publications. </font><a class="internal" href="/wiki/Special:BookSources/8820974274"><font color="#000000">ISBN 88-209-7427-4</font></a> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Fantoli-2005" class="book"><font color="#000000">Fantoli, Annibale (2005). <em><span>The Disputed Injunction and its Role in Galileo's Trial</span></em>. In </font><a href="#Reference-McMullin-2005"><font color="#000000">McMullin (2005, pp.117–149)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Disputed+Injunction+and+its+Role+in+Galileo%27s+Trial&rft.aulast=Fantoli&rft.aufirst=Annibale&rft.au=Fantoli%2C+Annibale&rft.date=2005&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite id="Reference-Favaro-1890"><font color="#000000">Favaro, Antonio (1890–1909), ed.</font><a class="external autonumber" title="http://www.domusgalilaeana.it/Exhibition/Protagonist/Favaro.htm" rel="nofollow" href="http://www.domusgalilaeana.it/Exhibition/Protagonist/Favaro.htm"><font color="#000000">[2]</font></a><font color="#000000">. <em><a class="external text" title="http://moro.imss.fi.it/lettura/LetturaWEB.DLL?AZIONE=CATALOGO" rel="nofollow" href="http://moro.imss.fi.it/lettura/LetturaWEB.DLL?AZIONE=CATALOGO">Le Opere di Galileo Galilei, Edizione Nazionale</a></em> <span style="COLOR: #555; FONT-SIZE: 0.95em; FONT-WEIGHT: bold" class="languageicon"><font size="3">(Italian)</font></span>. (<em>The Works of Galileo Galilei, National Edition</em>, 20 vols.), </font><a title="Florence" href="/wiki/Florence"><font color="#000000">Florence</font></a><font color="#000000">: Barbera, 1890–1909; reprinted 1929–1939 and 1964–1966. </font><a class="internal" href="/wiki/Special:BookSources/8809208811"><font color="#000000">ISBN 88-09-20881-1</font></a><font color="#000000">.</font></cite><font color="#000000"> Searchable online copy from the </font><a class="external text" title="http://www.imss.fi.it/istituto/index.html" rel="nofollow" href="http://www.imss.fi.it/istituto/index.html"><font color="#000000">Institute and Museum of the History of Science</font></a><font color="#000000">, Florence. Brief overview of <em>Le Opere</em> @ Finns Fine Books, </font><a class="external autonumber" title="http://www.finns-books.com/fgalileo.htm" rel="nofollow" href="http://www.finns-books.com/fgalileo.htm"><font color="#000000">[3]</font></a><font color="#000000"> and here </font><a class="external autonumber" title="http://www.pacifier.com/~tpope/Additional_Info.htm#National_Edition" rel="nofollow" href="http://www.pacifier.com/~tpope/Additional_Info.htm#National_Edition"><font color="#000000">[4]</font></a> </li>
| |
− | <li><font color="#000000">Feyerabend, Paul <em>Againat Method</em> Verso 1975</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Feyerabend-1995" class="book"><a title="Paul Feyerabend" href="/wiki/Paul_Feyerabend"><font color="#000000">Feyerabend, Paul</font></a><font color="#000000"> (1995). <em><span>Killing Time: The Autobiography of Paul Feyerabend</span></em>. Chicago, MI: University of Chicago Press. </font><a class="internal" href="/wiki/Special:BookSources/0226245314"><font color="#000000">ISBN 0-226-24531-4</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Killing+Time%3A+The+Autobiography+of+Paul+Feyerabend&rft.aulast=Feyerabend%2C+Paul&rft.au=Feyerabend%2C+Paul&rft.date=1995&rft.place=Chicago%2C+MI&rft.pub=University+of+Chicago+Press&rft.isbn=0-226-24531-4&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Fillmore, Charles (1931, 17th printing July 2004). <em>Metaphysical Bible Dictionary</em>. Unity Village, Missouri: Unity House. </font><a class="internal" href="/wiki/Special:BookSources/0871590670"><font color="#000000">ISBN 0-87159-067-0</font></a> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Finocchiaro-1989" class="book"><font color="#000000">Finocchiaro, Maurice A. (1989). <em><span>The Galileo Affair: A Documentary History</span></em>. Berkeley, CA: University of California Press. </font><a class="internal" href="/wiki/Special:BookSources/0520066626"><font color="#000000">ISBN 0-520-06662-6</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Galileo+Affair%3A+A+Documentary+History&rft.aulast=Finocchiaro%2C+Maurice+A.&rft.au=Finocchiaro%2C+Maurice+A.&rft.date=1989&rft.place=Berkeley%2C+CA&rft.pub=University+of+California+Press&rft.isbn=0-520-06662-6&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite id="Reference-Finocchiaro-2007"></cite><cite style="FONT-STYLE: normal" id="CITEREFFinocchiaro"><font color="#000000">Finocchiaro, Maurice A. (Fall 2007), "Book Review—The Person of the Millennium: The Unique Impact of Galileo on World History", <em>The Historian</em> <strong>69</strong> (3): 601–602, </font><a title="Digital object identifier" href="/wiki/Digital_object_identifier"><font color="#000000">doi</font></a><font color="#000000">:<span class="neverexpand"><a class="external text" title="http://dx.doi.org/10.1111%2Fj.1540-6563.2007.00189_68.x" rel="nofollow" href="http://dx.doi.org/10.1111%2Fj.1540-6563.2007.00189_68.x">10.1111/j.1540-6563.2007.00189_68.x</a></span></font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Ajournal&rft.genre=article&rft.atitle=Book+Review%E2%80%94The+Person+of+the+Millennium%3A+The+Unique+Impact+of+Galileo+on+World+History&rft.jtitle=The+Historian&rft.aulast=Finocchiaro&rft.aufirst=Maurice+A.&rft.au=Finocchiaro%2C+Maurice+A.&rft.date=Fall+2007&rft.volume=69&rft.issue=3&rft.pages=601%E2%80%93602&rft_id=info:doi/10.1111%2Fj.1540-6563.2007.00189_68.x&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Galileo-1960" class="book"><font color="#000000">Galilei, Galileo (1960) [1623]. <em><span>The Assayer</span></em>. translated by </font><a title="Stillman Drake" href="/wiki/Stillman_Drake"><font color="#000000">Stillman Drake</font></a><font color="#000000">. In </font><a href="#Reference-Drake.26O.27Malley-1960"><font color="#000000">Drake & O'Malley (1960, pp.151–336)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Assayer&rft.aulast=Galilei%2C+Galileo&rft.au=Galilei%2C+Galileo&rft.date=1960&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite id="Reference-Galileo-1954"><font color="#000000">Galilei, Galileo [1638, 1914] (1954), Henry Crew and Alfonso de Salvio, translators, <em><a class="external text" title="http://oll.libertyfund.org/index.php?option=com_staticxt&staticfile=show.php%3Ftitle=753&Itemid=99999999" rel="nofollow" href="http://oll.libertyfund.org/index.php?option=com_staticxt&staticfile=show.php%3Ftitle=753&Itemid=99999999">Dialogues Concerning Two New Sciences</a></em>, Dover Publications Inc., New York, NY. ISBN 486-60099-8</font></cite> </li>
| |
− | <li><font color="#000000">Galilei, Galileo <em>Galileo: Two New Sciences</em> (Translation by </font><a title="Stillman Drake" href="/wiki/Stillman_Drake"><font color="#000000">Stillman Drake</font></a><font color="#000000"> of Galileo's 1638 <em>Discourses and mathematical demonstrations concerning two new sciences</em>) University of Wisconsin Press 1974 </font><a class="internal" href="/wiki/Special:BookSources/029906400X"><font color="#000000">ISBN 0-299-06400-X</font></a> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Galileo.26Guiducci-1960" class="book"><font color="#000000">Galilei, Galileo, and Guiducci, Mario (1960) [1619]. <em><span>Discourse on the Comets</span></em>. translated by </font><a title="Stillman Drake" href="/wiki/Stillman_Drake"><font color="#000000">Stillman Drake</font></a><font color="#000000">. In </font><a href="#Reference-Drake.26O.27Malley-1960"><font color="#000000">Drake & O'Malley (1960, pp.21–65)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Discourse+on+the+Comets&rft.aulast=Galilei%2C+Galileo%2C+and+Guiducci%2C+Mario&rft.au=Galilei%2C+Galileo%2C+and+Guiducci%2C+Mario&rft.date=1960&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Gebler-1879" class="book">Gebler, Karl von (1879). <em><a class="external text" title="http://books.google.com/books?vid=OCLC02415342&id=FheRZAirWvQC" rel="nofollow" href="http://books.google.com/books?vid=OCLC02415342&id=FheRZAirWvQC">Galileo Galilei and the Roman Curia</a></em>. London: C.K. Paul & Co.<span class="printonly">. <a class="external free" title="http://books.google.com/books?vid=OCLC02415342&id=FheRZAirWvQC" rel="nofollow" href="http://books.google.com/books?vid=OCLC02415342&id=FheRZAirWvQC">http://books.google.com/books?vid=OCLC02415342&id=FheRZAirWvQC</a></span>.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+Galilei+and+the+Roman+Curia&rft.aulast=Gebler&rft.aufirst=Karl+von&rft.au=Gebler%2C+Karl+von&rft.date=1879&rft.place=London&rft.pub=C.K.+Paul+%26+Co.&rft_id=http%3A%2F%2Fbooks.google.com%2Fbooks%3Fvid%3DOCLC02415342%26id%3DFheRZAirWvQC&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><font color="#000000">Geymonat, Ludovico (1965), <em>Galileo Galilei, A biography and inquiry into his philosophy and science</em>, translation of the 1957 Italian edition, with notes and appendix by </font><a title="Stillman Drake" href="/wiki/Stillman_Drake"><font color="#000000">Stillman Drake</font></a><font color="#000000">, McGraw-Hill</font> </li>
| |
− | <li><font color="#000000">Grant, Edward <em>Aristotle, Philoponus, Avempace, and Galileo's Pisan Dynamics</em> Centaurus, 11, 1965-7</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Grassi-1960a" class="book"><font color="#000000">Grassi, Horatio (1960a) [1619]. <em><span>On the Three Comets of the Year MDCXIII</span></em>. translated by C.D. O'Malley. In </font><a href="#Reference-Drake.26O.27Malley-1960"><font color="#000000">Drake & O'Malley (1960, pp.3–19)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=On+the+Three+Comets+of+the+Year+MDCXIII&rft.aulast=Grassi%2C+Horatio&rft.au=Grassi%2C+Horatio&rft.date=1960a&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Grassi-1960b" class="book"><font color="#000000">Grassi, Horatio (1960b) [1619]. <em><span>The Astronomical and Philosophical Balance</span></em>. translated by C.D. O'Malley. In </font><a href="#Reference-Drake.26O.27Malley-1960"><font color="#000000">Drake & O'Malley (1960, pp.67–132)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Astronomical+and+Philosophical+Balance&rft.aulast=Grassi%2C+Horatio&rft.au=Grassi%2C+Horatio&rft.date=1960b&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Grisar, Hartmann, S.J., Professor of Church history at the University of Innsbruck (1882). </font><a class="external text" title="http://books.google.com/books?vid=ISBN0790562294&id=aqMBAAAAQAAJ&printsec=titlepage&dq=%22hartmann+grisar%22" rel="nofollow" href="http://books.google.com/books?vid=ISBN0790562294&id=aqMBAAAAQAAJ&printsec=titlepage&dq=%22hartmann+grisar%22"><em><font color="#000000">Historisch theologische Untersuchungen über die Urtheile Römischen Congegationen im Galileiprocess (Historico-theological Discussions concerning the Decisions of the Roman Congregations in the case of Galileo)</font></em></a><font color="#000000">, Regensburg: Pustet. – </font><a class="mw-redirect" title="Google Books" href="/wiki/Google_Books"><font color="#000000">Google Books</font></a><font color="#000000"> </font><a class="internal" href="/wiki/Special:BookSources/0790562294"><font color="#000000">ISBN 0-7905-6229-4</font></a><font color="#000000">. </font><a class="external text" title="http://isbndb.com/d/book/galileistudien.html" rel="nofollow" href="http://isbndb.com/d/book/galileistudien.html"><font color="#000000">(LCC# QB36 – <em>microfiche</em>)</font></a><font color="#000000"> </font><a class="external text" title="http://books.google.com/books?id=aqMBAAAAQAAJ&q=%22hartmann+grisar%22+%22Historisch+theologische%22&dq=%22hartmann+grisar%22+%22Historisch+theologische%22&ei=GOsIR_m6K4yKpwKygp3BDg&pgis=1" rel="nofollow" href="http://books.google.com/books?id=aqMBAAAAQAAJ&q=%22hartmann+grisar%22+%22Historisch+theologische%22&dq=%22hartmann+grisar%22+%22Historisch+theologische%22&ei=GOsIR_m6K4yKpwKygp3BDg&pgis=1"><font color="#000000">Reviewed here (1883), pp.211–213</font></a> </li>
| |
− | <li><font color="#000000">Hall, A. R. <em>From Galileo to Newton</em> 1963</font> </li>
| |
− | <li><font color="#000000">Hall, A. R. <em>Galileo and the Science of Motion</em> in 'British Journal of History of Science', 2 1964-5</font> </li>
| |
− | <li><font color="#000000">Hoskin, Michael (Ed) <em>The Cambridge concise history of astronomy</em> CUP 1999</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Hawking-1988" class="book"><a title="Stephen Hawking" href="/wiki/Stephen_Hawking"><font color="#000000">Hawking, Stephen</font></a><font color="#000000"> (1988). <em><span>A Brief History of Time</span></em>. New York, NY: Bantam Books. </font><a class="internal" href="/wiki/Special:BookSources/0553346148"><font color="#000000">ISBN 0-553-34614-8</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=A+Brief+History+of+Time&rft.aulast=Hawking%2C+Stephen&rft.au=Hawking%2C+Stephen&rft.date=1988&rft.place=New+York%2C+NY&rft.pub=Bantam+Books&rft.isbn=0-553-34614-8&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Heilbron-2005" class="book"><font color="#000000">Heilbron, John L. (2005). <em><span>Censorship of Astronomy in Italy after Galileo</span></em>. In </font><a href="#Reference-McMullin-2005"><font color="#000000">McMullin (2005, pp.279–322)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Censorship+of+Astronomy+in+Italy+after+Galileo&rft.aulast=Heilbron%2C+John+L.&rft.au=Heilbron%2C+John+L.&rft.date=2005&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Hellman, Hal (1988). <em>Great Feuds in Science. Ten of the Liveliest Disputes Ever</em>. New York: Wiley</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-jarrel-1989" class="book"><font color="#000000">Jarrel, Richard A. (1989). <em><span>The contemporaries of Tycho Brahe</span></em>. In </font><a href="#Reference-Taton.26Wilson-1989"><font color="#000000">Taton and Wilson (1989, pp.22–32)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+contemporaries+of+Tycho+Brahe&rft.aulast=Jarrel&rft.aufirst=Richard+A.&rft.au=Jarrel%2C+Richard+A.&rft.date=1989&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Kelter-2005" class="book"><font color="#000000">Kelter, Irving A. (2005). <em><span>The Refusal to Accommodate. Jesuit Exegetes and the Copernican System</span></em>. In </font><a href="#Reference-McMullin-2005"><font color="#000000">McMullin (2005, pp.38–53)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Refusal+to+Accommodate.+Jesuit+Exegetes+and+the+Copernican+System&rft.aulast=Kelter%2C+Irving+A.&rft.au=Kelter%2C+Irving+A.&rft.date=2005&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Humphreys, W. C. <em>Galileo, Falling Bodies and Inclined Planes. An Attempt at Reconstructing Galileo's Discovery of the Law of Squares</em> 'British Journal of History of Science' 1967</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Koestler-1990" class="book"><a title="Arthur Koestler" href="/wiki/Arthur_Koestler"><font color="#000000">Koestler, Arthur</font></a><font color="#000000"> (1990) [1959]. <em><span><a title="The Sleepwalkers" href="/wiki/The_Sleepwalkers">The Sleepwalkers</a>: A History of Man's Changing Vision of the Universe</span></em>. Penguin. </font><a class="internal" href="/wiki/Special:BookSources/0140192468"><font color="#000000">ISBN 0-14-019246-8</font></a><font color="#000000">.</font></cite><font color="#000000"><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=%5B%5BThe+Sleepwalkers%5D%5D%3A+A+History+of+Man%27s+Changing+Vision+of+the+Universe&rft.aulast=%5B%5BArthur+Koestler%7CKoestler%2C+Arthur%5D%5D&rft.au=%5B%5BArthur+Koestler%7CKoestler%2C+Arthur%5D%5D&rft.date=1990&rft.pub=Penguin&rft.isbn=0-14-019246-8&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span> Original edition published by Hutchinson (1959, London).</font> </li>
| |
− | <li><a class="mw-redirect" title="Koyré" href="/wiki/Koyr%C3%A9"><font color="#000000">Koyré</font></a><font color="#000000">, Alexandre <em>A Documentary History of the Problem of Fall from Kepler to Newton</em> Transaction of the American Philosophical Society, 1955</font> </li>
| |
− | <li><font color="#000000">Koyré, Alexandre <em>Galilean Studies</em> Harvester Press 1978</font> </li>
| |
− | <li><font color="#000000">Kuhn, T. <em>The Copernican Revolution</em> 1957</font> </li>
| |
− | <li><font color="#000000">Kuhn, T. <em>The Structure of Scientific Revolutions</em> 1962</font> </li>
| |
− | <li><font color="#000000">Lattis, James M. (1994). <em>Between Copernicus and Galileo: Christopher Clavius and the Collapse of Ptolemaic Cosmology</em>, Chicago: the University of Chicago Press</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Langford-1998" class="book"><font color="#000000">Langford, Jerome K., O.P. (1998) [1966]. <em><span>Galileo, Science and the Church</span></em> (third ed.). St. Augustine's Press. </font><a class="internal" href="/wiki/Special:BookSources/1890318256"><font color="#000000">ISBN 1-890318-25-6</font></a><font color="#000000">.</font></cite><font color="#000000"><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%2C+Science+and+the+Church&rft.aulast=Langford%2C+Jerome+K.%2C+O.P.&rft.au=Langford%2C+Jerome+K.%2C+O.P.&rft.date=1998&rft.edition=third&rft.pub=St.+Augustine%27s+Press&rft.isbn=1-890318-25-6&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span>. Original edition by Desclee (New York, NY, 1966)</font> </li>
| |
− | <li><font color="#000000">Lessl, Thomas, "</font><a class="external text" title="http://www.catholiceducation.org/articles/apologetics/ap0138.html" rel="nofollow" href="http://www.catholiceducation.org/articles/apologetics/ap0138.html"><font color="#000000">The Galileo Legend</font></a><font color="#000000">." <em>New Oxford Review</em>, 27–33 (June 2000).</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Linton-2004" class="book"><font color="#000000">Linton, Christopher M. (2004). <em><span>From Eudoxus to Einstein—A History of Mathematical Astronomy</span></em>. Cambridge: Cambridge University Press. </font><a class="internal" href="/wiki/Special:BookSources/9780521827508"><font color="#000000">ISBN 978-0-521-82750-8</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=From+Eudoxus+to+Einstein%E2%80%94A+History+of+Mathematical+Astronomy&rft.aulast=Linton%2C+Christopher+M.&rft.au=Linton%2C+Christopher+M.&rft.date=2004&rft.place=Cambridge&rft.pub=Cambridge+University+Press&rft.isbn=978-0-521-82750-8&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Losee, J. <em>Drake, Galileo, and the Law of Inertia</em> American Journal of Physics, 34, p. 430-2 1966</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-McMullin-2005" class="book"><font color="#000000">McMullin, Ernan, ed. (2005). <em><span>The Church and Galileo</span></em>. Notre Dame, IN: University of Notre Dame Press. </font><a class="internal" href="/wiki/Special:BookSources/0268034834"><font color="#000000">ISBN 0-268-03483-4</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Church+and+Galileo&rft.aulast=McMullin%2C+Ernan%2C+ed.&rft.au=McMullin%2C+Ernan%2C+ed.&rft.date=2005&rft.place=Notre+Dame%2C+IN&rft.pub=University+of+Notre+Dame+Press&rft.isbn=0-268-03483-4&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-McMullin-2005a" class="book"><font color="#000000">McMullin, Ernan, (2005a). <em><span>The Church's Ban on Copernicanism, 1616</span></em>. In </font><a href="#Reference-McMullin-2005"><font color="#000000">McMullin (2005, pp.150–190)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=The+Church%27s+Ban+on+Copernicanism%2C+1616&rft.aulast=McMullin%2C+Ernan%2C&rft.au=McMullin%2C+Ernan%2C&rft.date=2005a&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Mach, Ernst. <em>The Science of Mechanics</em> 1893</font> </li>
| |
− | <li><font color="#000000">Machamer, Peter (Ed) <em>The Cambridge Companion to Galileo</em> Cambridge University Press 1998</font> </li>
| |
− | <li><font color="#000000">Naylor, Ronald H. (1990). "Galileo's Method of Analysis and Synthesis," <em>Isis</em>, 81: 695–707</font> </li>
| |
− | <li><font color="#000000">Newall, Paul (2004). </font><a class="external text" title="http://www.galilean-library.org/hps.html" rel="nofollow" href="http://www.galilean-library.org/hps.html"><font color="#000000">"The Galileo Affair"</font></a> </li>
| |
− | <li><font color="#000000">Remmert, Volker R. (2005). <em>Galileo, God, and Mathematics</em>. In: Bergmans, Luc/Koetsier, Teun (eds.): <em>Mathematics and the Divine. A Historical Study</em>, Amsterdam et al., 347–360</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Ratzinger-1994" class="book"><a title="Pope Benedict XVI" href="/wiki/Pope_Benedict_XVI"><font color="#000000">Ratzinger, Joseph Cardinal</font></a><font color="#000000"> (1994). <em><span>Turning point for Europe? The Church in the Modern World—Assessment and Forecast</span></em>. translated from the 1991 German edition by Brian McNeil. San Francisco, CA: Ignatius Press. </font><a class="internal" href="/wiki/Special:BookSources/0898704618"><font color="#000000">ISBN 0-89870-461-8</font></a><font color="#000000">. </font><a title="Online Computer Library Center" href="/wiki/Online_Computer_Library_Center"><font color="#000000">OCLC</font></a><font color="#000000"> </font><a class="external text" title="http://worldcat.org/oclc/60292876" rel="nofollow" href="http://worldcat.org/oclc/60292876"><font color="#000000">60292876</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Turning+point+for+Europe%3F+The+Church+in+the+Modern+World%E2%80%94Assessment+and+Forecast&rft.aulast=Ratzinger%2C+Joseph+Cardinal&rft.au=Ratzinger%2C+Joseph+Cardinal&rft.date=1994&rft.place=San+Francisco%2C+CA&rft.pub=Ignatius+Press&rft_id=info:oclcnum/60292876&rft.isbn=0-89870-461-8&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite id=".23Reference-Reston-2000"></cite><cite style="FONT-STYLE: normal" id="CITEREFReston2000" class="book"><font color="#000000">Reston, James (2000). <em><span>Galileo: A Life</span></em>. Beard Books. </font><a class="internal" href="/wiki/Special:BookSources/189312262X"><font color="#000000">ISBN 1-893122-62-X</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%3A+A+Life&rft.aulast=Reston&rft.aufirst=James&rft.au=Reston%2C+James&rft.date=2000&rft.pub=Beard+Books&rft.isbn=1-893122-62-X&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000"><cite style="FONT-STYLE: normal" id="Reference-Seeger-1966" class="book">Seeger, Raymond J. (1966). <em><span>Galileo Galilei, his life and his works</span></em>. Oxford: Pergamon Press.</cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+Galilei%2C+his+life+and+his+works&rft.aulast=Seeger%2C+Raymond+J.&rft.au=Seeger%2C+Raymond+J.&rft.date=1966&rft.place=Oxford&rft.pub=Pergamon+Press&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span></font> </li>
| |
− | <li><cite id="Reference-Settle-1961"><font color="#000000">Settle, Thomas B. (1961). "An Experiment in the History of Science." <em>Science</em>, 133:19–23</font></cite> </li>
| |
− | <li><cite id="Reference-Sharratt-1994"><font color="#000000">Sharratt, Michael (1994), <em>Galileo: Decisive Innovator.</em> Cambridge University Press, Cambridge. </font><a class="internal" href="/wiki/Special:BookSources/0521566711"><font color="#000000">ISBN 0-521-56671-1</font></a></cite> </li>
| |
− | <li><font color="#000000">Shapere, Dudley <em>Galileo, a Philosophical Study</em> University of Chicago Press 1974</font> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Shea.26Artigas-2003" class="book"><font color="#000000">Shea, William R. and Artigas, Mario (2003). <em><span>Galileo in Rome: The Rise and Fall of a Troublesome Genius</span></em>. Oxford: Oxford University Press. </font><a class="internal" href="/wiki/Special:BookSources/0195165985"><font color="#000000">ISBN 0-19-516598-5</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo+in+Rome%3A+The+Rise+and+Fall+of+a+Troublesome+Genius&rft.aulast=Shea%2C+William+R.+and+Artigas%2C+Mario&rft.au=Shea%2C+William+R.+and+Artigas%2C+Mario&rft.date=2003&rft.place=Oxford&rft.pub=Oxford+University+Press&rft.isbn=0-19-516598-5&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Sobel-2000" class="book"><font color="#000000">Sobel, Dava (2000) [1999]. <em><span>Galileo's Daughter</span></em>. London: Fourth Estate. </font><a class="internal" href="/wiki/Special:BookSources/1857027124"><font color="#000000">ISBN 1-85702-712-4</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%27s+Daughter&rft.aulast=Sobel%2C+Dava&rft.au=Sobel%2C+Dava&rft.date=2000&rft.place=London&rft.pub=Fourth+Estate&rft.isbn=1-85702-712-4&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Taton.26Wilson-1989" class="book"><font color="#000000">Taton, René; Wilson, Curtis, eds (1989). <em><span>Planetary astronomy from the Renaissance to the rise of astrophysics Part A: Tycho Brahe to Newton</span></em>. Cambridge: Cambridge University Press. </font><a class="internal" href="/wiki/Special:BookSources/0521242541"><font color="#000000">ISBN 0-521-24254-1</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Planetary+astronomy+from+the+Renaissance+to+the+rise+of+astrophysics+Part+A%3A+Tycho+Brahe+to+Newton&rft.date=1989&rft.place=Cambridge&rft.pub=Cambridge+University+Press&rft.isbn=0-521-24254-1&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Thoren-1989" class="book"><font color="#000000">Thoren, Victor E. (1989). <em><span>Tycho Brahe</span></em>. In </font><a href="#Reference-Taton.26Wilson-1989"><font color="#000000">Taton and Wilson (1989, pp.3-21)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Tycho+Brahe&rft.aulast=Thoren&rft.aufirst=Victor+E.&rft.au=Thoren%2C+Victor+E.&rft.date=1989&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Vanhelden-1989" class="book"><font color="#000000">Van Helden, Albert (1989). <em><span>Galileo, telescopic astronomy, and the Copernican system</span></em>. In </font><a href="#Reference-Taton.26Wilson-1989"><font color="#000000">Taton and Wilson (1989, pp.81-105)</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Galileo%2C+telescopic+astronomy%2C+and+the+Copernican+system&rft.aulast=Van+Helden&rft.aufirst=Albert&rft.au=Van+Helden%2C+Albert&rft.date=1989&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">Wallace, William A. (1984) <em>Galileo and His Sources: The Heritage of the Collegio Romano in Galileo's Science,</em> (Princeton: Princeton Univ. Pr.), </font><a class="internal" href="/wiki/Special:BookSources/069108355X"><font color="#000000">ISBN 0-691-08355-X</font></a> </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="Reference-Wallace-2004" class="book"><font color="#000000">Wallace, William A. (2004). <em><span>Domingo de Soto and the Early Galileo</span></em>. Aldershot: Ashgate Publishing. </font><a class="internal" href="/wiki/Special:BookSources/0860789640"><font color="#000000">ISBN 0-86078-964-0</font></a><font color="#000000">.</font></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=book&rft.btitle=Domingo+de+Soto+and+the+Early+Galileo&rft.aulast=Wallace&rft.aufirst=William+A.&rft.au=Wallace%2C+William+A.&rft.date=2004&rft.place=Aldershot&rft.pub=Ashgate+Publishing&rft.isbn=0-86078-964-0&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"><font color="#000000"> </font></span></span> </li>
| |
− | <li><font color="#000000">White, Andrew Dickson (1898). </font><a class="external text" title="http://cscs.umich.edu/~crshalizi/White/" rel="nofollow" href="http://cscs.umich.edu/~crshalizi/White/"><em><font color="#000000">A History of the Warfare of Science with Theology in Christendom</font></em></a><font color="#000000">. New York 1898.</font> </li>
| |
− | <li><font color="#000000">White, Michael. (2007). <em>Galileo: Antichrist: A Biography.</em> Weidenfeld & Nicolson:London, </font><a class="internal" href="/wiki/Special:BookSources/9780297848684"><font color="#000000">ISBN 978-0-297-84868-4</font></a><font color="#000000">.</font> </li>
| |
− | <li><font color="#000000">Wisan, Winifred Lovell (1984). "Galileo and the Process of Scientific Creation," <em>Isis</em>, 75: 269–286.</font> </li>
| |
− | <li><font color="#000000">Zik Yaakov, "Science and Instruments: The telescope as a scientific instrument at the beginning of the seventeenth century," <em>Perspectives on Science</em> 2001, Vol. 9, 3, 259–284.</font> </li>
| |
− | </ul>
| |
− | </div>
| |
− | <p><a id="External_links" name="External_links"></a></p>
| |
− | <h2><span class="mw-headline">External links</span></h2>
| |
− | <ul>
| |
− | <li><a class="external text" title="http://www.imss.fi.it/" rel="nofollow" href="http://www.imss.fi.it/"><font color="#000080">History of Science Museum - Florence</font></a> </li>
| |
− | <li><a class="external text" title="http://www-history.mcs.st-andrews.ac.uk/PictDisplay/Galileo.html" rel="nofollow" href="http://www-history.mcs.st-andrews.ac.uk/PictDisplay/Galileo.html"><font color="#000080">Portraits of Galileo</font></a> </li>
| |
− | <li><a class="external text" title="http://asv.vatican.va/en/stud/download/CAV_21.htm" rel="nofollow" href="http://asv.vatican.va/en/stud/download/CAV_21.htm"><font color="#000080">Original documents on the trial of Galileo Galilei</font></a> in the <a title="Vatican Secret Archives" href="/wiki/Vatican_Secret_Archives"><font color="#000080">Vatican Secret Archives</font></a> </li>
| |
− | <li><a class="external text" title="http://web.archive.org/web/20071209222631/http://www.catholic.net/rcc/Periodicals/Issues/GalileoAffair.html" rel="nofollow" href="http://web.archive.org/web/20071209222631/http://www.catholic.net/rcc/Periodicals/Issues/GalileoAffair.html"><font color="#000080">Galileo Affair catholic.net</font></a> </li>
| |
− | <li><a class="external text" title="http://galileo.rice.edu/" rel="nofollow" href="http://galileo.rice.edu/"><font color="#000080">The Galileo Project</font></a> at <a title="Rice University" href="/wiki/Rice_University"><font color="#000080">Rice University</font></a> </li>
| |
− | <li><a class="external text" title="http://www.pbs.org/wgbh/nova/galileo/" rel="nofollow" href="http://www.pbs.org/wgbh/nova/galileo/"><font color="#000080">PBS Nova Online: <em>Galileo's Battle for the Heavens</em></font></a> </li>
| |
− | <li><a class="external text" title="http://plato.stanford.edu/entries/galileo/" rel="nofollow" href="http://plato.stanford.edu/entries/galileo/"><font color="#000080">Stanford Encyclopedia of Philosophy entry on Galileo</font></a> </li>
| |
− | <li><a class="external text" title="http://www.galilean-library.org/" rel="nofollow" href="http://www.galilean-library.org/"><font color="#000080">The Galilean Library</font></a>, educational site. </li>
| |
− | <li><a class="external text" title="http://www.catholicleague.org/research/galileo.html" rel="nofollow" href="http://www.catholicleague.org/research/galileo.html"><em><font color="#000080">Galileo and the Catholic Church</font></em></a> article at Catholic League </li>
| |
− | <li><a class="external text" title="http://www.imdb.com/title/tt0956139/" rel="nofollow" href="http://www.imdb.com/title/tt0956139/"><em><font color="#000080">Animated Hero Classics: Galileo (1997)</font></em></a> at the <a title="Internet Movie Database" href="/wiki/Internet_Movie_Database"><font color="#000080">Internet Movie Database</font></a> </li>
| |
− | <li><a class="external text" title="http://www.mpiwg-berlin.mpg.de/Galileo_Prototype/MAIN.HTM" rel="nofollow" href="http://www.mpiwg-berlin.mpg.de/Galileo_Prototype/MAIN.HTM"><font color="#000080">Electronic representation of Galilei's notes on motion (MS. 72)</font></a> </li>
| |
− | <li><a class="external text" title="http://worldcat.org/identities/lccn-n79-3254" rel="nofollow" href="http://worldcat.org/identities/lccn-n79-3254"><font color="#000080">Works by or about Galileo Galilei</font></a> in libraries (<a title="WorldCat" href="/wiki/WorldCat"><font color="#000080">WorldCat</font></a> catalog) </li>
| |
− | <li>Galileo's 1590 <em>De Motu</em> translation <a class="external autonumber" title="http://echo.mpiwg-berlin.mpg.de/content/scientific_revolution/galileo" rel="nofollow" href="http://echo.mpiwg-berlin.mpg.de/content/scientific_revolution/galileo"><font color="#000080">[5]</font></a> </li>
| |
− | <li><a class="external text" title="http://www.intratext.com/Catalogo/Autori/AUT158.HTM" rel="nofollow" href="http://www.intratext.com/Catalogo/Autori/AUT158.HTM"><font color="#000080">Works by Galileo Galilei</font></a>: text with concordances and frequencies. </li>
| |
− | <li><a class="external text" title="http://www.pacifier.com/~tpope/" rel="nofollow" href="http://www.pacifier.com/~tpope/"><font color="#000080">CCD Images through a Galilean Telescope</font></a> Modern recreation of what Galileo might have seen </li>
| |
− | <li>Galilei, Galileo. <a class="external text" title="http://www.rarebookroom.org/Control/galgal/index.html" rel="nofollow" href="http://www.rarebookroom.org/Control/galgal/index.html"><em><font color="#000080">Le Operazioni del Compasso Geometrico et Militare</font></em></a> 1610 Rome. From <a title="Rare Book Room" href="/wiki/Rare_Book_Room"><font color="#000080">Rare Book Room</font></a>. Scanned first edition. </li>
| |
− | <li>Galilei, Galileo. <a class="external text" title="http://www.rarebookroom.org/Control/galsol/index.html" rel="nofollow" href="http://www.rarebookroom.org/Control/galsol/index.html"><em><font color="#000080">Istoria e Dimostrazioni Intorno Alle Macchie Solar</font></em></a> 1613 Rome. From <a title="Rare Book Room" href="/wiki/Rare_Book_Room"><font color="#000080">Rare Book Room</font></a>. Scanned first edition. </li>
| |
− | <li><cite style="FONT-STYLE: normal" id="CITEREFO.27ConnorRobertson"><a class="mw-redirect" title="John J. O'Connor (mathematician)" href="/wiki/John_J._O%27Connor_(mathematician)"><font color="#000080">O'Connor, John J.</font></a>; <a title="Edmund F. Robertson" href="/wiki/Edmund_F._Robertson"><font color="#000080">Robertson, Edmund F.</font></a>, "<a class="external text" title="http://www-history.mcs.st-andrews.ac.uk/Biographies/Galileo.html" rel="nofollow" href="http://www-history.mcs.st-andrews.ac.uk/Biographies/Galileo.html"><font color="#000080">Galileo Galilei</font></a>", <em><span><a title="MacTutor History of Mathematics archive" href="/wiki/MacTutor_History_of_Mathematics_archive"><font color="#000080">MacTutor History of Mathematics archive</font></a></span></em></cite><span class="Z3988" title="ctx_ver=Z39.88-2004&rft_val_fmt=info%3Aofi%2Ffmt%3Akev%3Amtx%3Abook&rft.genre=bookitem&rft.btitle=Galileo+Galilei&rft.atitle=%5B%5BMacTutor+History+of+Mathematics+archive%5D%5D&rft.aulast=O%27Connor&rft.aufirst=John+J.&rft.au=O%27Connor%2C+John+J.&rft.au=Robertson%2C+Edmund+F.&rfr_id=info:sid/en.wikipedia.org:Galileo_Galilei"><span style="DISPLAY: none"> </span></span>. </li>
| |
− | <li>Linda Hall Library features a <a class="external text" title="http://contentdm.lindahall.org/u?/classics,5292" rel="nofollow" href="http://contentdm.lindahall.org/u?/classics,5292"><font color="#000080">first edition of <em>Sidereus Nuncius Magna</em></font></a> as well as a <a class="external text" title="http://contentdm.lindahall.org/u?/classics,426" rel="nofollow" href="http://contentdm.lindahall.org/u?/classics,426"><font color="#000080">pirated edition from the same year</font></a>, both fully digitized. </li>
| |
− | <li><a class="external text" title="http://www.youtube.com/watch?v=5C5_dOEyAfk&feature=related" rel="nofollow" href="http://www.youtube.com/watch?v=5C5_dOEyAfk&feature=related"><font color="#000080">Feather & Hammer Drop on Moon</font></a> </li>
| |
− | </ul>
| |